DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and Fndc1

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:XP_006227933.1 Gene:Fndc1 RGDID:1310640 Length:1831 Species:Rattus norvegicus

Alignment Length:530 Identity:117/531 (22%)
Similarity:166/531 (31%) Gaps:199/531 (37%)


  Fly   210 RKLP----QNILSVEEYIKESLF------LETSAAK--------SLYRSLRLDTESVEIKRIMDE 256
            |.||    |::.:.||...|.:.      |.||..|        ..|....||.:...|      
  Rat  1108 RPLPLESQQSVFAEEEEENEGMLKGKEDSLSTSVKKWPSSSSPRDKYADRNLDKDKAAI------ 1166

  Fly   257 QVVRSAAILKEAQTVPTSQTQLEKRLMKKGSTPATPPVHPKPNPNTTPKPKNPLLRSHSADEEPD 321
                 ..:::|..|||..:            .|.:|.:  ..:|:|..:|:||      |...|.
  Rat  1167 -----GLLVQEENTVPGRR------------PPGSPAI--ASHPSTRHQPRNP------ATASPI 1206

  Fly   322 IDVENAPVIQGSFEGSFEIT------------KTDADIARKKTPP----TRAYQA---ASSTLPP 367
            .:..:.|........|:..|            :....::|:..||    |..|..   |...:||
  Rat  1207 ANTHSWPRYTTRAPSSYSSTTPMLSLRQRMQRRFRTPVSRQPPPPRPVLTPGYNGRPNAEENIPP 1271

  Fly   368 KAIAV-------------------------------------TPFSLRVKPKKPSIEKL---TTV 392
            .:|..                                     .|..:|:.....:|..|   ..|
  Rat  1272 GSIGKPNGQRIINGPQGTKWVVDLDRGLVLNAEGRYLQDSHGNPLRVRLGGDGRTIVDLGGTPMV 1336

  Fly   393 LPQQLPT------GGPISSTR---------ATTKATKATTTTTKRTTTSTTRKTTTTTTPKPTTT 442
            .|..||.      |.|::|.:         ......:...|||:..||:....|||||.| ||||
  Rat  1337 SPDGLPLFGQGRHGKPVASAQDKPILSLGGKPLVGLEVVRTTTQVPTTTMPPSTTTTTVP-PTTT 1400

  Fly   443 ---TTTTEATTTTTTSTTTTTPPLPPSTTRATTTSTNTFTYPSVNTPPP----------NQGGSL 494
               ||||...||||..||||.  .|.:|||||..:|.|.|.|...||.|          ::.|:|
  Rat  1401 LPPTTTTTRRTTTTRRTTTTR--RPTTTTRATRRTTTTTTTPEPTTPSPTCPPGTLEHRDEAGNL 1463

  Fly   495 -------PKL---------------------------DANLFTTFPILDTQPWRPMHREVPELLP 525
                   |:.                           |..|.||.|...|.|  ......|:::|
  Rat  1464 IMGSNGIPECYPEEDDFSGLEIDTALPTEEDYVVYDDDYGLETTRPPTSTMP--STTAATPKVVP 1526

  Fly   526 --GPPPAFPTK----------------------TLPGGTTPTVNHIPQRRIDEFELPFIADNPTP 566
              |...:||.:                      ..|...|..::|.....:||.....:..|..|
  Rat  1527 EQGTVSSFPEEEFDLAGKRRFVAPYVTYLSKDPAAPCSLTDALDHFQVESLDELIPNDLTKNDLP 1591

  Fly   567 PTAAVAPVTV 576
            |..|...:||
  Rat  1592 PQHAPRNITV 1601

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
Fndc1XP_006227933.1 FN3 37..117 CDD:214495
FN3 155..238 CDD:214495
FN3 258..351 CDD:238020
fn3 359..444 CDD:278470
Treacle 530..1059 CDD:281536
FN3 1595..1686 CDD:238020 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23197
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.