DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and Tmprss15

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:XP_017453433.1 Gene:Tmprss15 RGDID:1311046 Length:1057 Species:Rattus norvegicus

Alignment Length:188 Identity:46/189 (24%)
Similarity:83/189 (44%) Gaps:43/189 (23%)


  Fly    79 RNIAPSTFSAKTHTQYPKNRSFSI--ILTTAAFIVLLTVISIAGLAFYFSSIKTNLED-PVMG-- 138
            ||:|..            :||.|.  ::.:|.|:||: |:|:..:...:.::|.:..| ..:|  
  Rat     5 RNVAAG------------HRSISSFEVMVSALFMVLM-VLSVGLIVVSWLAVKESETDAAALGKS 56

  Fly   139 --FEGSFRIAKGDLFSTGLKYNHTTTYK-------QKIDFYKRFVERSMMDNGLQPLRTDVWGFG 194
              ..|.|:|..|..::..|:...:..:|       |.||   ...|.|.:.|..:..|  |:.|.
  Rat    57 HEVRGRFKITSGVTYNPNLQDKFSVDFKVLAFDLQQMID---EIFESSNLKNEYKKSR--VFQFE 116

  Fly   195 DGPLIKVSFRVFLDVRKLPQNILSVEEYIKESLF--LETSAAKSLYRSLRLDTESVEI 250
            :|.:| |.|.:|     ..|.:  .:|.:||.|.  :|.:.:..|. :|.:|..|::|
  Rat   117 NGSVI-VLFDLF-----FAQWV--SDENVKEELIQGIEANISSQLV-TLHIDLNSIDI 165



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BGTX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.