DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and ABI3BP

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:XP_005247338.1 Gene:ABI3BP HGNCID:17265 Length:1793 Species:Homo sapiens

Alignment Length:1233 Identity:266/1234 (22%)
Similarity:422/1234 (34%) Gaps:350/1234 (28%)


  Fly   211 KLPQNILSVEEYIKESLFLETSAAKSLYRSLRLDTESVEIKRIMDEQVVRSAAILKEA---QTVP 272
            |||.:::     .:.|..|:|..||:...:|..::::.|:::|.    .|...:..|.   .|.|
Human   293 KLPASLM-----FEISDALKTQLAKNETLALPAESKTPEVEKIS----ARPTTVTPETVPRSTKP 348

  Fly   273 TSQTQL---EKRLMKKGSTPAT-------------PPVHPKPNPN----TTP----KPKNPLLRS 313
            |:.:.|   |..|:....||.|             ..:.||..|.    .||    ||:..|   
Human   349 TTSSALDVSETTLVLSKRTPETLQTILIPQFELPLSTLAPKSLPEFPEAKTPFPFEKPRGTL--- 410

  Fly   314 HSADEEPDI--------------------DVENAPVIQGSFEGSFEITKTDADIARKKTPPT-RA 357
             ::.|:|.|                    ||.::|......|.|...|.|...|.....|.| |.
Human   411 -ASSEKPWIVPTAKISEDSKVLQPQTATYDVFSSPTTSDEPEISDSYTATSDRILDSIPPKTSRT 474

  Fly   358 YQAASSTLPPKAIAVTPFSLRVKPKKPSIEKLTTVLPQQLPTGGPISSTRATTKATKATTTTTKR 422
            .:...:||.|......|..|.:. ..|.::. ||..|||..:   |.||.......|...|..:|
Human   475 LEQPRATLAPSETPFVPQKLEIF-TSPEMQP-TTPAPQQTTS---IPSTPKRRPRPKPPRTKPER 534

  Fly   423 TTTSTTRKTTTTTTPKPTTTT----------------TTTEATTT-------TTTSTTTTTPPLP 464
            ||::.|.....:.:|:||.||                .:.|.|.|       |...:.:|..|..
Human   535 TTSAGTITPKISKSPEPTWTTPAPGKTQFISLKPKIPLSPEVTHTKPAPEPQTLLPSQSTIGPET 599

  Fly   465 PSTTRATTTSTNTFTYPS---------VNTPPPNQGGSLPKLDANLFTTFPILDTQPWRPMHR-- 518
            |.|..:||.:......|.         ..||.|....|.|.|:.......|::.|...:|..|  
Human   600 PGTKPSTTLAPRKTKRPGRRPRPRPRPKTTPSPEVPKSKPALEPATIQPEPLVPTTASKPSERPK 664

  Fly   519 -----EVPELLPGPPPAFPTKTLPGGTTPTVNHIPQRRIDEFELPFIADNPT---PPTAAVAPVT 575
                 :.|::.||..|  |.:.||...|.....:|..:.....:||..:.|:   .||..:.|||
Human   665 TTHRPDAPQIQPGSKP--PKQLLPKPQTTAEPDMPPTKSVSEPVPFETEAPSMTIVPTTDIEPVT 727

  Fly   576 V-DPYSLGFLNP----GLRVQEPKPNLGPQAQDQDMLFYHNFGSPIFMPGTENIERLGGALV-EP 634
            | ...::..|.|    ..|.:.|:|......:.:.:....:|| || .|||.:......... .|
Human   728 VRTEATVTTLAPKTSQRTRTRRPRPKHKTTPRPETLQTKLDFG-PI-TPGTSSAPTTTTKRTRRP 790

  Fly   635 HPLP-------VP---LIDDVIIPPFKPIDATMGTGDKMPFNLDASNERFEHLGGGVIAKKPQEK 689
            ||.|       ||   |:...|:.|..                     |.|..|.....|.||..
Human   791 HPKPKTTPHPEVPQTKLVPATILEPVL---------------------RTEASGTTAAPKVPQRT 834

  Fly   690 LEKKEQPS---KKEQLEAHVKEA---NQTAPEKKKAQAHNDQKADQPEITTKVERKQEKVEVTTL 748
            .....:|.   ..|:|:..:..|   ...:|.|:..........|...:|.:.|     :..|||
Human   835 HRPHPKPKTTLSPEELQTELVPATIFEPVSPIKEAPGTTFVPVTDLEPVTFRTE-----IPATTL 894

  Fly   749 ATNV-----PVKSSPKPTKSPSLPSLKPTDNSVLADTIGEFFMELLNLPKEENATATKK------ 802
            ||..     |.:..||.|.||..|..||...:||         |.:.|..|.:.|...|      
Human   895 ATKTSKRTRPPRPRPKTTPSPQAPETKPVPATVL---------EPVTLRPEASTTLASKTSQRTR 950

  Fly   803 ---------PIEDAIESRIEPEEE--------ESLDTLKAPSVS------LSKPNFMNLKEIILQ 844
                     |..:|.||:..|..|        |:..|.:||..|      ..|.......|:...
Human   951 RPRLRTKTTPRPEAPESKPVPTAELKPVTLRTETWVTTQAPKTSQRTRRPRPKTKTTPSPEVPQT 1015

  Fly   845 RNTPSSILSNETLEESTTTTMPTTTT------RT----TTEEPRT--TKRNRIR-TTSERPTMMD 896
            :..||:.|...||......||..||.      ||    ||..|:|  |:|.|.| .|:..|.:..
Human  1016 KLVPSTDLEPGTLRTEAPKTMVVTTVLEPDTFRTKFPETTLAPKTQRTRRPRPRPKTTSSPEVPQ 1080

  Fly   897 DSNLFPSHSKWE-FVNSSSAQG--FG----HNSNMRKVFNQTLQAWVSEDI-DKSENLTLN---- 949
            :.::  |.:.:| .|:|:.|.|  |.    ....::.|.:.:|:...|:.: |..|::||:    
Human  1081 NKSV--SVTGFEPVVHSTDAPGTTFALTELQTLILKPVTSPSLEMTESQPVSDVLESVTLSTESP 1143

  Fly   950 -----------------------DIKTRINNASNIQDISLIFDTLASKLGITP------SVPNKF 985
                                   :.||.:     ::.|:.:.:...:.|..:|      ::|:..
Human  1144 KETIAPAKTDYVYPTAKAPLWPEEPKTEV-----VESITYVSEPPETTLETSPLPSQSITLPSPD 1203

  Fly   986 PPFSQNKLKHAPK-----------------------EEVTRRPIPS-----STTTEIP--LLIPE 1020
            .|.::...|..|:                       :.||.:|..|     |.||..|  :|:|.
Human  1204 EPQTEPAPKQTPRAPPKPKTSPRPRIPQTQPVPKVPQRVTAKPKTSPSPEVSYTTPAPKDVLLPH 1268

  Fly  1021 SILP--VEREPFIKPMSSFIDDGSSEVLGAAIPVIGEAEVEVVDPLNYEEMLK--ISQFAASSTE 1081
            ...|  .:.||.::|::...:...:.:  |.:...|...:.::.|...:|.|:  :.:...|:.|
Human  1269 KPYPEVSQSEPVLQPVTFRFEPPKTTI--APLETRGIPFIPMISPSPSQEELQTTLEETDQSTQE 1331

  Fly  1082 PSVHKL------------------------------------VTLLPVR-------SNSGIRT-- 1101
            |...|:                                    .|..|.|       |.:|:.|  
Human  1332 PFTTKIPRTTELAKTTQAPHRFYTTVRPRTSDKPHIRPVLNRTTTRPTRPKPSGMPSGNGVGTGV 1396

  Fly  1102 ---YRPPAADEETQRSASAPAPLAAPAPAPAPLPGKISIRRKSNLNQSRRFGQPPAEAVVKGG 1161
               .||..||...  |..:..|...|.....|||.:.:..|:..|..:...|:|.:..::..|
Human  1397 KQAPRPSGADRNV--SVDSTHPTKKPGTRRPPLPPRPTHPRRKPLPPNNVTGKPGSAGIISSG 1457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
ABI3BPXP_005247338.1 fn3 123..211 CDD:278470
FN3 1557..1648 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23197
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.