DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and Tmprss15

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:NP_032967.1 Gene:Tmprss15 MGIID:1197523 Length:1069 Species:Mus musculus

Alignment Length:1090 Identity:196/1091 (18%)
Similarity:316/1091 (29%) Gaps:458/1091 (42%)


  Fly    99 SFSIILTTAAFIVLLTVISIAGLAFYFSSIKTNLEDPVMG----FEGSFRIAKGDLFSTGLKYNH 159
            ||.::|  :|..::|.|.||..:|..:.::|.:..|..:|    ..|:|:|..|..::..|:..|
Mouse    16 SFEVML--SALFIMLMVFSIGLIAVSWLAVKESEGDAALGKSHEVRGTFKITSGVTYNPNLQDKH 78

  Fly   160 TTTYK-------QKIDFYKRFVERSMMDNGLQPLRTDVWGFGDGPLIKVSFRVFLDVRKLPQNIL 217
            :..:|       |.||   ...|.|.:.|..:  ::.|:.|..|.:| |.|.:|.......:|  
Mouse    79 SVDFKVLAFDLQQMID---EIFESSSLKNEYE--KSKVFQFEKGSVI-VLFDLFFAQWVSDKN-- 135

  Fly   218 SVEEYIKESLF--LETSAAKSLYRSLRLDTESVEIKRIMDEQVVRSAAILKEAQTVPTSQTQLEK 280
                 :||.|.  :|.:.:..|. :|.:|..|::|...:.:                        
Mouse   136 -----VKEELIQGIEANISSQLV-TLHIDLNSIDITASLSD------------------------ 170

  Fly   281 RLMKKGSTPATPPVHPKPNPNTTPKPKNPLLRSHSADEEPDIDVENAPVIQGSFEGSFEITKTDA 345
                  .|.|.|                                               :|.:| 
Mouse   171 ------FTTAVP-----------------------------------------------VTTSD- 181

  Fly   346 DIARKKTPPTRAYQAASSTLPPKAIAVTPFSLRVKPKKPSIEKLTTVLPQQLPTGGPISSTRATT 410
                                                      ||||..|.             ||
Mouse   182 ------------------------------------------KLTTSSPM-------------TT 191

  Fly   411 KATKATTTTTKRTTTSTTRKTTTTTTPKPTTTTTTTEATTTTTTSTTTTTPPLPPSTTRATTTST 475
            .|:....:||...|||.           |....:|....||:...:....|...|........:|
Mouse   192 SASLGNLSTTVAATTSA-----------PLCNLSTATFATTSGHVSIECQPGSRPCAHAWNCVAT 245

  Fly   476 NTFTYPSVNTPPPNQGGSLPKLDANLFTT-----FPILDTQPWRPMHREVPELLPGPPPAFPTKT 535
            :.|....||.|..:..      |..|..|     |                 ||.|....|....
Mouse   246 DLFCDGEVNCPDGSDE------DTGLCATACDGRF-----------------LLTGDSGVFQADR 287

  Fly   536 LPGGTTPTVNHIPQRRIDEFELPFIADNPTPPTAAVAPVTVDPYSLGFLNPGLRVQEPKPNLGPQ 600
            .|             |.||             :..|....:.      :|.||.::         
Mouse   288 YP-------------RPDE-------------SGVVCRWIIR------VNQGLSIR--------- 311

  Fly   601 AQDQDMLFYHNFGSPIFMPGTENI----ERLG------GALVEPHPLPVPLIDDVIIPPF----- 650
                     .||||  |:|...::    |.:|      |:..|..|..:.:..:::...|     
Mouse   312 ---------MNFGS--FIPHYTDVLDIYEGIGPSKILRGSFWETDPGTIRIFSNLVTVTFLIKSD 365

  Fly   651 ----------------------KPIDATMGTGDKMPF-----NLDASNE---------------R 673
                                  :.||.|...|    |     :||..||               |
Mouse   366 EYDYIGFNATYSTFNNSELNNYEKIDCTFDDG----FCFWTQDLDDDNEWERIQVTTFPCYTGPR 426

  Fly   674 FEHL---GGGVIAKKPQEK-------------LEKKEQP-----------SKKEQLEAHVKEANQ 711
            |:|.   |.|.....|.|:             |:...:|           .....|..|:..|..
Mouse   427 FDHTYGNGSGFYISTPTEQGWRSERVGLSSLSLDLTSEPVCLHFWYYMCCENVYNLNIHISSAET 491

  Fly   712 TAPEKKKAQAHNDQKADQPEITTKVERKQEKV--------EVTTLA------TNVPVKSS--PKP 760
            |.....:.:.:..:..:..::|.. |..:.||        ..:|:|      ||.....|  |:|
Mouse   492 TDKIVFQRKGNYGRNWNYGQVTLN-ETGEFKVVFNAFRNRGCSTIALDDISLTNGICSQSPYPEP 555

  Fly   761 TKSPSLPSLKPTDNSVLADTIGEFFMELLNLPKEENATATKKPIEDAIESRIEPEEEE---SLDT 822
            |..|:.|...|||..      |.|  ||.    |.|:|.:.....|..     |.:..   :|:.
Mouse   556 TLVPTPPPELPTDCG------GPF--ELW----EPNSTFSSPNFPDKY-----PNQASCIWNLNA 603

  Fly   823 LKAPSVSLSKPNF--MNLKEIILQRN---TPSSILSNET----LEESTTTTMPTTTTRTTTEEPR 878
            .:..::.|....|  .|:.:::..|:   ..|.:|:..|    :::..:||...|...||..|.|
Mouse   604 QRGKNIQLHFQEFDLENINDVVEVRDGGEFDSLLLAVYTGPGPVKDLFSTTNRMTVIFTTNMETR 668

  Fly   879 TTKRNRIRTTS------ERPTMMD-----DSNLFP----------------SHSKWEFVNSSSAQ 916
             .|..:...||      ..|...|     |.|..|                ..|...|:|.:.:.
Mouse   669 -RKGFKANFTSGYYLGIPEPCQDDEFQCKDGNCIPLGNLCDSYPHCRDGSDEASCVRFLNGTRSN 732

  Fly   917 GFGHNSNMRKVF------NQTLQAWVSEDIDK-----SENLTLNDIKT------RINNASNIQDI 964
            ......|:..::      |.|.|  :|.::..     |.|.::....|      |:|.|.|    
Mouse   733 NGLVQFNIHSIWHIACAENWTTQ--ISNEVCHLLGLGSANSSMPISSTGGGPFVRVNQAPN---- 791

  Fly   965 SLIFDTLASKLGITPSVPNKFPPFSQNKL-------KHAPKEEVTRRPIP 1007
                    ..|.:|||:     ..||:.|       |...:::||::..|
Mouse   792 --------GSLILTPSL-----QCSQDSLILLQCNHKSCGEKKVTQKVSP 828

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
Tmprss15NP_032967.1 SEA 53..154 CDD:214554 27/115 (23%)
LDLa 228..261 CDD:197566 7/33 (21%)
CUB 270..376 CDD:294042 25/175 (14%)
MAM 392..549 CDD:279023 28/162 (17%)
MAM 392..547 CDD:99706 28/160 (18%)
CUB 569..676 CDD:278839 25/125 (20%)
LDLa 688..722 CDD:238060 5/34 (15%)
SR 723..816 CDD:214555 22/112 (20%)
SRCR 728..819 CDD:278931 20/110 (18%)
Tryp_SPc 829..1064 CDD:214473 196/1091 (18%)
Tryp_SPc 830..1066 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BGTX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.