DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and F49E10.2

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:NP_508986.1 Gene:F49E10.2 WormBaseID:WBGene00018640 Length:842 Species:Caenorhabditis elegans

Alignment Length:656 Identity:153/657 (23%)
Similarity:239/657 (36%) Gaps:207/657 (32%)


  Fly     3 TVYGT--------KKYFQSLSGVSDIYRAQTCRQMSADYTYQNTVGRRSQLGAYYHMNKQPSYTN 59
            |::|:        :::||.:..|                   :|.|.|..:|.|           
 Worm   218 TIWGSFSAMNFEEQRFFQGIFTV-------------------DTNGVRRVVGLY----------- 252

  Fly    60 EHSLNSQYGYNTWGIWRDGRNIAPSTFSAKTHTQYPKNRS-----FSIILTTAAFIVL-LTVISI 118
                       .:|:|        .|.:..::.:|..:::     ...|.:|..||:| :|.:.|
 Worm   253 -----------DYGVW--------DTNACGSNDEYIGDKTLLPGYIHSITSTENFIILPITSLLI 298

  Fly   119 AGLAFYFSSIKTNLEDPVMGFEGSFRIAKGDLFSTGLKYNHTTTYKQKIDFY----KRFV---ER 176
            ....|        .|.|:.....:  |.||.|:.              :|||    .||:   ::
 Worm   299 NPCKF--------KEPPLNNVRSA--IQKGGLWG--------------MDFYDMVPMRFLIFNKK 339

  Fly   177 SMMDNGLQPL----------RTDVWGFGDGPLIKVSFRVFLDVRKLPQNILSVEEYIKESLFLET 231
            ::.....:||          :.:.:...||..  |:..|..|         |.:.|:|  .|...
 Worm   340 TLEFTTSKPLEVFPSMFVTHQLNAFEADDGNF--VADMVVYD---------SHDPYVK--YFYTD 391

  Fly   232 SAAKSLY----RSLRLDTESVEIKRIMDEQVVRSAAILKEAQTVPTSQTQLEKRLMKKGSTPATP 292
            ...|.||    |.||...:|.: :|:|...:|....|   |...|......|::..:.|....  
 Worm   392 FLTKQLYPSTARVLRFTLDSKK-QRVMYNYLVPQETI---AADFPQFNHNYEQKPYQWGYLVQ-- 450

  Fly   293 PVHPKPNPNTTPK--------------PKNPLLRSHSA--DEEPDI--DVENAPVIQG--SFEGS 337
              ||..:.|:..|              ...|.|..|..  .::||.  :.|...:::|  :.|..
 Worm   451 --HPFASGNSIIKINVDEPAGNRNLEFRAEPTLVLHEPWFVQKPDSKKEDEGVLIVRGLDTAENK 513

  Fly   338 FEITKTDADIARKKTPPTRAYQAASSTLP---------------PKAIAVTPFSLRVKPKKPSIE 387
            ..:...||:   |.....|||...|  :|               |:...|.....|...||   :
 Worm   514 GVLIVIDAE---KMVELGRAYVPIS--IPFGFHNRFFSKKDLGLPEGFQVGQSQYRPIEKK---Q 570

  Fly   388 KLTTVLPQQLPTGGPISSTRATTKATKATTTTTKRTTTSTTRKTTTTTTPKPTT-TTTTTEATTT 451
            ...|:..:::.|..|.:||.:|| ..|.:||||..:||.|:..||||||||||| |:|:|..|||
 Worm   571 GFATLPLRKVSTVPPTTSTSSTT-TQKPSTTTTVPSTTPTSTTTTTTTTPKPTTSTSTSTSTTTT 634

  Fly   452 TTTSTTTTTPPLPPSTT---RATTTSTNTFTYPSVNTPPPNQGGSLPKLDANLFTTFPILDT--- 510
            ||||||.||.|.|.:||   :..|.:|.|:|.|...|.......::|.....:...:|:..:   
 Worm   635 TTTSTTATTTPQPTTTTTSEKPVTLTTQTWTAPPTTTVKRTTPQTVPTTTPKIPRWWPLAGSGST 699

  Fly   511 -QPWRPMHREVPELLPGPPPAFPTKTLPGGTTPTVNHIPQRRIDE-----FELPFIADNPTPPTA 569
             |||....:.....|   ||.||.               .:|::|     ...|..:||..|.. 
 Worm   700 EQPWWQKVQTGQNTL---PPLFPV---------------SKRVEEKVEKVSAKPNESDNKIPEQ- 745

  Fly   570 AVAPVT 575
              .|||
 Worm   746 --KPVT 749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
F49E10.2NP_508986.1 RPE65 46..546 CDD:299160 79/427 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.