DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and abi3bp

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:XP_009303055.1 Gene:abi3bp ID: Length:1067 Species:Danio rerio

Alignment Length:892 Identity:195/893 (22%)
Similarity:292/893 (33%) Gaps:297/893 (33%)


  Fly   269 QTVPTSQTQLEKR----LMKKGSTPAT--------PPV-HPKPNPNTTP-------KPKNPLLRS 313
            ||.|:|.|.::..    |.:.|....|        ||| |...:....|       |||.|:|  
Zfish   184 QTCPSSSTVIDNLKPDVLYEFGVRAETDSKCGAWSPPVIHNTDDQIIRPFKELNQAKPKKPIL-- 246

  Fly   314 HSADEEPDIDVENAPVIQGSFEGSFEITKTDADIARKKTPP-------TRAYQAASSTLPPKAIA 371
              ||::|.:                              ||       |||  |....||     
Zfish   247 --ADQKPFL------------------------------PPVPLLNNITRA--APLLELP----- 272

  Fly   372 VTPFSLRVKPKKPSIE--KLTTVLPQQLPTGGPISST--------RATTKATKATTTTTKRTT-- 424
                    ||.|.|:.  :.|:.:..|.||..|.:|.        .:||....|||.....||  
Zfish   273 --------KPWKNSVSTPETTSTVQSQSPTNDPTTSQPDLFTEQHTSTTPQQPATTQQQSSTTQQ 329

  Fly   425 -TSTTRKTT----------------------------TTTTPKPTTT----TTTTEATTTTTTST 456
             ||||:.||                            :||:|.||||    |||.|..|||..:.
Zfish   330 QTSTTQPTTQEYIKTQISTKDPPYTAKQQFSETTSPVSTTSPIPTTTKPQQTTTKEPDTTTQENL 394

  Fly   457 -TTTTPP------LPPSTTRATTTSTNTFTYPSVNTPPPNQGGSLPKLD-ANLFTTFPILDTQPW 513
             |..|.|      |.|...|.|:....|.|||...|....|..::...: ||   |.|...|..|
Zfish   395 YTRKTQPRNKMQRLRPFRFRGTSKQQTTHTYPLPKTTSYYQSSTITLSEYAN---TKPPTTTVSW 456

  Fly   514 RPMHREVPELLPGPPPAFPTKTLPGGTTPTVNHIPQRRIDEFELPFIADNPTPPTAAVAPVTVDP 578
            ......|            |.|....|| |:.:|.    |:.......|....|..:....|...
Zfish   457 STNSHSV------------TNTALTSTT-TITNIQ----DDVTSQQTTDVSRQPVFSTTASTYTK 504

  Fly   579 YSLGFLNPGLRVQEPKPNLGPQAQDQDMLFYHNFGSPIFMPGTENIERLGGALVEPHPLPVPLID 643
            ||:..:              |..:|           |......:.:.|      :|..||:..  
Zfish   505 YSIFHI--------------PTTED-----------PPLNKSEQELTR------QPVNLPITF-- 536

  Fly   644 DVIIPPFKPIDATMGTGDKMPFNLDASNERF---EHLGGGVIAKKPQEKLEKKEQPSKKEQLEAH 705
                 .:||..:|.......| ...||..:|   :|:.....:..|:|:|...::|...:  .|.
Zfish   537 -----GYKPQPSTATQQSNTP-KQRASTAKFVLKQHIQDESQSHNPEERLPGTQKPLLNQ--TAF 593

  Fly   706 VK-EANQTAPEKKKAQAHNDQKADQPEITTKVERKQEKV--------EVT--------------- 746
            :| :|.|.:|..:|......|:: ||  |...:||.::|        ||.               
Zfish   594 IKFDAIQNSPVTEKVTVRTSQQS-QP--TASSQRKDKRVLSQPTLTNEVAGRNKGRGIFRNSSSV 655

  Fly   747 --TLATNVPVKSSPKPTKSPSLPSL--KPTDNSVLADTIGEFFMELL-NLPKEENATATKKPIED 806
              .||.||..:..|..|....||.:  ..|.|...... ||..:.|. |.|:       |:|::.
Zfish   656 SYPLARNVTQRLRPLSTNHLKLPPVPRNSTPNKKRGPH-GEGHIGLHGNKPR-------KQPVKP 712

  Fly   807 AIESRIEPEEEESLDTLK----------APSVSLSKPNFMNLKEIILQRNTPSSILSNETLEEST 861
            .:....:.:|:|.:..||          .|..:..||                   :|:.|.::|
Zfish   713 KLNQVSDTKEKEIITDLKQIDPVPELKPLPPPTTEKP-------------------ANQELSQTT 758

  Fly   862 TTTMPTTTTRTTTE-------------EPRTTKR----NRIRTTSERP----TMMDDSNLFPSHS 905
            |.......:|..|:             :|...||    :.:..|.:||    ::.:..:.||.  
Zfish   759 TPQSAFEGSRFDTDNSSVYSNHPRLELDPAGKKRFVAPHVVYRTDKRPEEPCSVTNSLSFFPD-- 821

  Fly   906 KWEFVNSSSAQGFGHN--SNMRKVFNQTLQAWVSEDIDKSENLTLNDIKTRINNASNIQDISLIF 968
              |.|...:..|....  ||:..|..:...::|..|.||::|.|............:.:::|:  
Zfish   822 --EEVGYLNVTGPPKTPPSNLTVVTVEGCSSFVILDWDKTDNETTEYEVVSSTKGPHGEEVSI-- 882

  Fly   969 DTLASKLGITPSVPNKFPPFSQNKLKHAPKEEVTRRPI--PSSTTTE 1013
                .....|.:......|.|..:.|..||.|:...|.  |.|.:||
Zfish   883 ----QTTNQTHTAVENLKPESSYEFKVTPKNELGSGPSSDPVSFSTE 925

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
abi3bpXP_009303055.1 FN3 129..225 CDD:238020 12/41 (29%)
FN3 836..924 CDD:238020 20/94 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23197
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.