DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and tmprss15

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:XP_012813424.1 Gene:tmprss15 XenbaseID:XB-GENE-999987 Length:1038 Species:Xenopus tropicalis

Alignment Length:215 Identity:41/216 (19%)
Similarity:75/216 (35%) Gaps:60/216 (28%)


  Fly   763 SPSLPSLKPTDNSVLADTIGEFFMELLNLPKEENATATKKPIEDAIESRI-------------EP 814
            :|||.:....|...||..:.:...|:......::...:.:.:|....|.|             |.
 Frog    79 TPSLQNQSSVDFKTLAFDVQQLIYEIFQAGLLKSVYKSCQVLEFRNGSVIVLFKLHFTQITANEN 143

  Fly   815 EEEESLDTLKAPSVSLSKPNFMNLKEIILQRNTPSSILSNETLEESTTTTMPTTTTRTTTEEPRT 879
            ..:|.:..::|.:..::|..|                :.|.|:..:....|.||:..||.....|
 Frog   144 IHQELVLGIEANNADINKKFF----------------IDNTTIVIADAQEMATTSPSTTLNGATT 192

  Fly   880 TKRNR------------------IRTT------SERPTMMDDSNLF---PSHSKWEFVNSSSAQG 917
            ||:|.                  |:.|      |:.|...|:...|   |...:: |:  |.|.|
 Frog   193 TKQNTTLGQCPPDERICADSSFCIQETRFCDGLSDCPDGSDEHEKFCSTPCDGQF-FL--SEASG 254

  Fly   918 FGHNSNMRKVFNQTLQA-WV 936
            ..|:.|..::::..|.. |:
 Frog   255 TFHSKNYPQLYDPNLSCRWI 274

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
tmprss15XP_012813424.1 SEA 66..156 CDD:279699 13/77 (17%)
LDLa 201..234 CDD:197566 5/33 (15%)
CUB 243..349 CDD:238001 8/36 (22%)
MAM 365..523 CDD:279023
MAM 365..521 CDD:99706
CUB 545..652 CDD:278839
LDLa 664..698 CDD:238060
SR 699..790 CDD:214555
Tryp_SPc 803..1033 CDD:214473
Tryp_SPc 804..1035 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BGTX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.