DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and abi3bpb

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:XP_005161833.1 Gene:abi3bpb ZFINID:ZDB-GENE-030131-6041 Length:807 Species:Danio rerio

Alignment Length:609 Identity:124/610 (20%)
Similarity:189/610 (31%) Gaps:243/610 (40%)


  Fly   358 YQAASST------LPPKAIAVTPFSLRVKP---------KKPSI------EKLTTV-----LPQQ 396
            ||..|::      |.|.    ||:...|:|         .||.|      :|:..:     .|..
Zfish   173 YQTCSTSDTVIDNLKPN----TPYEFGVRPNKDDRSGMWSKPVIHNTNMGDKIMQINYKHNRPIA 233

  Fly   397 LPTGGPISSTRATTKATKATTTTTKRTTTSTTRKTTTTTTPKPTTTTTTTEATTTTTTSTTTTTP 461
            .|.|||.|                                |.|..                    
Zfish   234 KPLGGPHS--------------------------------PFPLR-------------------- 246

  Fly   462 PLPPSTTR-ATTTSTNTFTYPSVN-TPPPNQGGSL--PKLDANLFTTFPILDTQPWRPMH----- 517
            |:|.:.:. ..:.:|..|..|..: .||..|.|::  |:.:...:...| |||.    .|     
Zfish   247 PVPNNISHPVPSKNTGIFGGPKTSFAPPMGQQGTVAAPRANEPKWPQLP-LDTD----SHVRNDS 306

  Fly   518 ---REVPELLPGPPPAFPTKTLPGGTTPTVNHI-----------PQRRI-DEFELPF-------- 559
               .|:|.:|   |...|||......|||...:           ||.:. ...::|.        
Zfish   307 SQLVEIPRIL---PQLLPTKPFRSSATPTPQSLTSSTRAPLHGHPQNKAPSATQMPHGSSGKNIR 368

  Fly   560 --IADNPTPPTAAVAPVTV--------DPYSLGFLNPGLRVQEPKPNLGPQAQDQDMLFYHNFGS 614
              |:..|:.|..:|..||.        :|:|  |.| |:|  ...|.||..::.......|:.|.
Zfish   369 GDISSLPSKPANSVLTVTTRNQTSLGRNPFS--FSN-GMR--HSPPRLGDPSRRHGANGEHHKGL 428

  Fly   615 PIFMPGTENIERLGGALVEPHPLPVPLIDDVIIPPFKPIDATMGTGDKMPFNLDASNERFEHLGG 679
            ....|...:..|:|.:...|:                       ...|.| |:...:||      
Zfish   429 SFPKPAIWSRARMGSSAGRPN-----------------------NALKNP-NVVGMHER------ 463

  Fly   680 GVIAK--KPQEKLEKKE-----------QPSKKEQLEAHVKEANQTAPE--------------KK 717
              |.|  ||....:|..           :|||.:...|    .:.|||:              ..
Zfish   464 --IGKDMKPDVNQDKASILMPKLPPVTAKPSKPKTTSA----PSVTAPKYETWENSSSFSPVPAS 522

  Fly   718 KAQAHNDQKADQPEITTKVERK-QEKVEVTTLATNVP--------VKSSPKPTKS---------- 763
            |..|...::...|.:..|.::| .|...:||..|..|        |.:.||...|          
Zfish   523 KVDAMGKERYIAPHVVYKTDKKPDEPCSITTSLTYFPEEEGGEQNVTNPPKTAPSNLTVVTVEGC 587

  Fly   764 PSLPSL--KPTDN-----SVLADTIGEFFMELLNLPKEENATATK--KPIEDAIESRIEPEEE-- 817
            ||...|  :.|||     .|::.|.|....::..|...:..||.:  || |.:.|.:::|:.|  
Zfish   588 PSFIILDWEKTDNETTEYEVISTTKGPDGEQVSILTTNQTHTAVENLKP-ESSYEFKVKPKNELG 651

  Fly   818 ------------ESLDTLKAPSVS 829
                        ||.|...:.:||
Zfish   652 EGPSSEPVSFSTESADPRVSENVS 675

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
abi3bpbXP_005161833.1 FN3 121..197 CDD:214495 8/28 (29%)
FN3 575..663 CDD:238020 19/89 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23197
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.