DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1273 and tmprss15

Sequence 1:NP_647883.1 Gene:CG1273 FlyBaseID:FBgn0035522 Length:1168 Species:Drosophila melanogaster
Sequence 2:XP_001919639.2 Gene:tmprss15 ZFINID:ZDB-GENE-091204-83 Length:990 Species:Danio rerio

Alignment Length:369 Identity:66/370 (18%)
Similarity:109/370 (29%) Gaps:119/370 (32%)


  Fly     7 TKKYFQSLSGVSDIYRAQTCRQMSADYTYQNTVGRRSQLGAYYHMNKQPSYTNEHSLNSQY--GY 69
            |..||.|.:...|::...  .:.:|::..|  .|.|....|.|.......::||..:|..:  .:
Zfish   248 TLAYFLSGTSPGDLWLLS--HEATAEFNSQ--TGNRQGFNATYMAVNISDFSNEEKINCSFEEDF 308

  Fly    70 NTW-------GIWRDGRNIAPSTFSAKTHTQYPKNRSFSIILTTAA-----------FIVLLTVI 116
            ..|       |.|...:...|.:.:..:......|:|...|:|...           .:.|....
Zfish   309 CLWRKELNDDGEWVRAQGETPPSDTGPSFDHTTGNQSGYYIVTPRTSGNWERKFRLYSLPLTPTK 373

  Fly   117 SIAGLAFYFSSIKTNLEDPVMGFEGSFRIAKGDLFSTGLKYNHTTTYKQKIDFYKRFVERSMMDN 181
            .:..|.|::.....::....:..||...|               |...||        |.:..||
Zfish   374 ELMCLQFWYHMFGEHVRRLTVTSEGRSTI---------------TVLFQK--------EGNYGDN 415

  Fly   182 GLQPLRTDVWGFGDGPLIKVSFRVFLDVRKLPQNILSVEEYIKESLFLETSAAKSLYRSLRLDTE 246
                     |.:|...|                || |.:..:    ..|...:..:...:.||..
Zfish   416 ---------WNYGQATL----------------NI-SADTVV----VFEAQKSSGILNDIALDDI 450

  Fly   247 SVEIKRIMDEQVVRSAAILKEAQTVPTSQTQLEKRLMKKGSTPATPPVHPKPN---------PNT 302
            |:                      ||.|..|:     ....||..|||:|..:         ||:
Zfish   451 SI----------------------VPGSCEQI-----PPDPTPVPPPVNPPEDCGGPFDLYEPNS 488

  Fly   303 T-PKPKNPLLRSHSADEEPDIDVENAPVIQGSF-----EGSFEI 340
            | ..|..|....|:|.....:..:....||..|     |.|:::
Zfish   489 TFSSPNYPDGYGHNASCMWTLHAKEGQNIQLHFQDVALEASYDV 532

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1273NP_647883.1 None
tmprss15XP_001919639.2 SEA 19..>89 CDD:279699
LDLa 142..175 CDD:238060
CUB 183..288 CDD:238001 11/44 (25%)
MAM 302..457 CDD:279023 33/230 (14%)
MAM 302..457 CDD:99706 33/230 (14%)
CUB 477..586 CDD:238001 12/57 (21%)
LDLa 596..630 CDD:238060
SRCR_2 653..728 CDD:295335
Tryp_SPc 747..977 CDD:214473
Tryp_SPc 748..980 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BGTX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.