DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and ATP6V0E1

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_003936.1 Gene:ATP6V0E1 HGNCID:863 Length:81 Species:Homo sapiens

Alignment Length:72 Identity:28/73 (38%)
Similarity:45/73 (62%) Gaps:0/73 (0%)


  Fly     7 PVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVV 71
            |::..:..||.||..:|...||||::.:|..:|:..:.||:||||...:||:|||.||:||.:.:
Human     9 PLIVMSVFWGFVGFLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKNETI 73

  Fly    72 AMIGRSW 78
            ..:...|
Human    74 WYLKYHW 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 25/58 (43%)
ATP6V0E1NP_003936.1 ATP_synt_H 9..67 CDD:310236 25/58 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2308683
eggNOG 1 0.900 E1_KOG3500
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5114
Isobase 1 0.950 0 Normalized mean entropy S2878
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1613627at2759
OrthoFinder 1 1.000 FOG0001163
OrthoInspector 1 1.000 T130273
orthoMCL 1 0.900 OOG5_129204
Panther 1 1.100 O PTHR12263
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2893
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.