DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and AT5G55290

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001154781.1 Gene:AT5G55290 AraportID:AT5G55290 Length:70 Species:Arabidopsis thaliana

Alignment Length:63 Identity:27/64 (42%)
Similarity:36/64 (56%) Gaps:5/64 (8%)


  Fly     9 LFFTALWGGVGI----AMPIMTPKGPHQNLIRCILMLTA-ACCWLFWLCCYMAQMNPLIGPKL 66
            |..|.::..|||    .:.|...:||..||:...|::|| .|||:.|...|:|||||||.|.|
plant     4 LITTLIFVVVGIIASLCVRICCNRGPSTNLLHLTLVITATVCCWMMWAIVYIAQMNPLIVPIL 66

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 26/61 (43%)
AT5G55290NP_001154781.1 ATP_synt_H 2..65 CDD:283211 26/61 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2559
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1613627at2759
OrthoInspector 1 1.000 T124382
orthoMCL 1 0.900 OOG5_129204
Panther 1 1.100 LDO PTHR12263
Phylome 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.