DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-a and AT5G55290

DIOPT Version :9

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a / 38521 FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001154781.1 Gene:AT5G55290 / 835622 AraportID:AT5G55290 Length:70 Species:Arabidopsis thaliana


Alignment Length:63 Identity:27/63 - (42%)
Similarity:36/63 - (57%) Gaps:5/63 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFFTALWGGVGI----AMPIMTPKGPHQNLIRCILMLTA-ACCWLFWLCCYMAQMNPLIGPKL 66
            |..|.::..|||    .:.|...:||..||:...|::|| .|||:.|...|:|||||||.|.|
plant     4 LITTLIFVVVGIIASLCVRICCNRGPSTNLLHLTLVITATVCCWMMWAIVYIAQMNPLIVPIL 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:398897 25/60 (42%)
AT5G55290NP_001154781.1 ATP_synt_H 2..65 CDD:368469 25/60 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4362
eggNOG 1 0.900 - - E1_KOG3500
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2631
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1613627at2759
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 1 1.000 - - otm2716
orthoMCL 1 0.900 - - OOG6_102348
Panther 1 1.100 - - LDO PTHR12263
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1797
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.