DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and AT4G26710

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_194401.1 Gene:AT4G26710 AraportID:AT4G26710 Length:70 Species:Arabidopsis thaliana

Alignment Length:54 Identity:27/55 (49%)
Similarity:32/55 (58%) Gaps:5/55 (9%)


  Fly    18 VGIAMPIMT----PKGPHQNLIRCILMLTA-ACCWLFWLCCYMAQMNPLIGPKL 66
            |||...|.|    .|||..||:...|::|| .|||:.|...|:|||||||.|.|
plant    13 VGIIASICTRICFNKGPSTNLLHLTLVITATVCCWMMWAIVYIAQMNPLIVPIL 66

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 26/52 (50%)
AT4G26710NP_194401.1 ATP_synt_H 3..65 CDD:283211 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2559
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1613627at2759
OrthoInspector 1 1.000 T124382
orthoMCL 1 0.900 OOG5_129204
Panther 1 1.100 LDO PTHR12263
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.