DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and atpv0e2

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001166106.1 Gene:atpv0e2 ZFINID:ZDB-GENE-050522-135 Length:81 Species:Danio rerio

Alignment Length:72 Identity:35/73 (48%)
Similarity:48/73 (66%) Gaps:0/73 (0%)


  Fly     7 PVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVV 71
            |::.||.|||.|||..|.:.||||::.:|...|:|||.||:||||...:||.|||.||:||.:.:
Zfish     9 PMIGFTTLWGLVGIVAPFLVPKGPNRGVIITSLVLTAVCCYLFWLVAILAQANPLFGPQLKNETI 73

  Fly    72 AMIGRSW 78
            ..:...|
Zfish    74 WYLRYYW 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 32/58 (55%)
atpv0e2NP_001166106.1 ATP_synt_H 9..67 CDD:283211 32/58 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2297400
eggNOG 1 0.900 E1_KOG3500
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5104
OMA 1 1.010
OrthoDB 1 1.010 D1613627at2759
OrthoFinder 1 1.000 FOG0001163
OrthoInspector 1 1.000 T128802
orthoMCL 1 0.900 OOG5_129204
Panther 1 1.100 LDO PTHR12263
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2893
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.