DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and atp6v0e1

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001006038.2 Gene:atp6v0e1 ZFINID:ZDB-GENE-041010-133 Length:81 Species:Danio rerio

Alignment Length:71 Identity:31/72 (43%)
Similarity:44/72 (61%) Gaps:0/72 (0%)


  Fly     8 VLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVVA 72
            :...|.|||.||..:|...|||.::.:|..:|:|||.||:||||...::|:|||.||.||.|.:.
Zfish    10 IAVMTLLWGLVGGVIPWFIPKGANRGVIVTMLVLTAVCCYLFWLIAILSQLNPLFGPVLKNDTIW 74

  Fly    73 MIGRSW 78
            .:...|
Zfish    75 YLYYHW 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 27/57 (47%)
atp6v0e1NP_001006038.2 ATP_synt_H 10..67 CDD:310236 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2304215
eggNOG 1 0.900 E1_KOG3500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1613627at2759
OrthoFinder 1 1.000 FOG0001163
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129204
Panther 1 1.100 O PTHR12263
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.