DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and Atp6v0e2

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001002253.1 Gene:Atp6v0e2 RGDID:1303238 Length:81 Species:Rattus norvegicus

Alignment Length:72 Identity:34/73 (47%)
Similarity:48/73 (66%) Gaps:0/73 (0%)


  Fly     7 PVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVV 71
            ||:.||..||.:|||.|...||||::.:|..:|:.||.||:||||...:||:|||.||:||.:.:
  Rat     9 PVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETI 73

  Fly    72 AMIGRSW 78
            ..:...|
  Rat    74 WYVRFLW 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 31/58 (53%)
Atp6v0e2NP_001002253.1 ATP_synt_H 9..67 CDD:336125 31/58 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2301028
eggNOG 1 0.900 E1_KOG3500
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5024
OMA 1 1.010
OrthoDB 1 1.010 D1613627at2759
OrthoFinder 1 1.000 FOG0001163
OrthoInspector 1 1.000 T131288
orthoMCL 1 0.900 OOG5_129204
Panther 1 1.100 LDO PTHR12263
Phylome 1 0.910 0.600 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.