DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and VhaM9.7-d

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_650578.1 Gene:VhaM9.7-d FlyBaseID:FBgn0038458 Length:88 Species:Drosophila melanogaster

Alignment Length:80 Identity:25/81 (31%)
Similarity:46/81 (57%) Gaps:3/81 (4%)


  Fly     4 AFFPVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKR 68
            ||..:..|..|:..:|.   :::.:...:.||||.::|||.||:|.|:..::.|:|||.||:.|:
  Fly     6 AFMVITVFWLLFAIIGF---LVSYRYEERGLIRCCVILTAVCCYLAWMVTFVMQLNPLTGPRAKQ 67

  Fly    69 DVVAMIGRSWNNPIV 83
            .::..:...|...|:
  Fly    68 KIILGMITYWPRSII 82

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 20/58 (34%)
VhaM9.7-dNP_650578.1 ATP_synt_H 7..64 CDD:283211 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131313614
eggNOG 1 0.900 E1_KOG3500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2878
OrthoDB 1 1.010 D1613627at2759
OrthoFinder 1 1.000 FOG0001163
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12263
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2893
76.920

Return to query results.
Submit another query.