DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and VhaM9.7-b

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001262170.1 Gene:VhaM9.7-b FlyBaseID:FBgn0028663 Length:89 Species:Drosophila melanogaster

Alignment Length:74 Identity:37/75 (49%)
Similarity:51/75 (68%) Gaps:1/75 (1%)


  Fly     9 LFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVVAM 73
            :..|::|..:||..|... :||::.:.:|.||||||.||||||||||.|:||||||||..:.:.:
  Fly     9 IVITSIWAFIGIICPFFA-RGPNRGVTQCCLMLTAATCWLFWLCCYMTQLNPLIGPKLSMNEIMI 72

  Fly    74 IGRSWNNPI 82
            :.|.|.|.|
  Fly    73 MAREWGNEI 81

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 31/56 (55%)
VhaM9.7-bNP_001262170.1 ATP_synt_H 9..64 CDD:283211 31/56 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131313580
eggNOG 1 0.900 E1_KOG3500
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I2559
Isobase 1 0.950 0 Normalized mean entropy S2878
OrthoDB 1 1.010 D1613627at2759
OrthoFinder 1 1.000 FOG0001163
orthoMCL 1 0.900 OOG5_129204
Panther 1 1.100 P PTHR12263
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2893
98.870

Return to query results.
Submit another query.