DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-a and vma9

DIOPT Version :9

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a / 38521 FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001343007.1 Gene:vma9 / 3361294 PomBaseID:SPBC1685.16 Length:67 Species:Schizosaccharomyces pombe


Alignment Length:63 Identity:21/63 - (33%)
Similarity:34/63 - (53%) Gaps:3/63 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GAAFFPVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGP 64
            |.....|...|||   :.:....::|||.:.:..:..|:||.:||:|.|...|:||::||..|
pombe     3 GLVVLLVGLLTAL---MSVVSYYVSPKGNNTSTWQMSLILTFSCCYLLWAITYLAQLHPLEAP 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:398897 20/58 (34%)
vma9NP_001343007.1 ATP_synt_H 14..62 CDD:310236 17/50 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I3641
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102348
Panther 1 1.100 - - LDO PTHR12263
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2893
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.