powered by:
Protein Alignment VhaM9.7-a and vma9
DIOPT Version :9
| Sequence 1: | NP_001097499.1 |
Gene: | VhaM9.7-a / 38521 |
FlyBaseID: | FBgn0035521 |
Length: | 85 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001343007.1 |
Gene: | vma9 / 3361294 |
PomBaseID: | SPBC1685.16 |
Length: | 67 |
Species: | Schizosaccharomyces pombe |
| Alignment Length: | 63 |
Identity: | 21/63 - (33%) |
| Similarity: | 34/63 - (53%) |
Gaps: | 3/63 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 GAAFFPVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGP 64
|.....|...||| :.:....::|||.:.:..:..|:||.:||:|.|...|:||::||..|
pombe 3 GLVVLLVGLLTAL---MSVVSYYVSPKGNNTSTWQMSLILTFSCCYLLWAITYLAQLHPLEAP 62
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
1 |
1.000 |
43 |
1.000 |
Domainoid score |
I3641 |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
1 |
1.000 |
- |
- |
|
|
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001872 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102348 |
| Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12263 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2893 |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.940 |
|
Return to query results.
Submit another query.