DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and vma9

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001343007.1 Gene:vma9 PomBaseID:SPBC1685.16 Length:67 Species:Schizosaccharomyces pombe

Alignment Length:63 Identity:21/64 (33%)
Similarity:34/64 (53%) Gaps:3/64 (5%)


  Fly     2 GAAFFPVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGP 64
            |.....|...|||   :.:....::|||.:.:..:..|:||.:||:|.|...|:||::||..|
pombe     3 GLVVLLVGLLTAL---MSVVSYYVSPKGNNTSTWQMSLILTFSCCYLLWAITYLAQLHPLEAP 62

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 20/59 (34%)
vma9NP_001343007.1 ATP_synt_H 14..62 CDD:310236 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001163
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129204
Panther 1 1.100 LDO PTHR12263
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2893
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.