DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and VMA9

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_958835.1 Gene:VMA9 SGDID:S000028508 Length:73 Species:Saccharomyces cerevisiae

Alignment Length:63 Identity:17/64 (27%)
Similarity:35/64 (55%) Gaps:1/64 (2%)


  Fly     3 AAFFPVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPK 65
            ::|:.|:....:...:.:...||.||. :|.:.|..::||.|..:|.|...::.|::||:.|:
Yeast     2 SSFYTVVGVFIVVSAMSVLFWIMAPKN-NQAVWRSTVILTLAMMFLMWAITFLCQLHPLVAPR 63

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 16/58 (28%)
VMA9NP_958835.1 ATP_synt_H 6..63 CDD:310236 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001163
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_129204
Panther 1 1.100 LDO PTHR12263
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2893
TreeFam 1 0.960
65.990

Return to query results.
Submit another query.