DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and vha-17

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_501636.2 Gene:vha-17 WormBaseID:WBGene00009882 Length:86 Species:Caenorhabditis elegans

Alignment Length:74 Identity:26/75 (35%)
Similarity:48/75 (64%) Gaps:0/75 (0%)


  Fly     7 PVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVV 71
            |::..:|.|..:|...|.:.||||::.:|:.::::||.|||:||:..::.|:||||||::....:
 Worm     6 PLVSVSAFWAIIGFGGPWIVPKGPNRGIIQLMIIMTAVCCWMFWIMVFLHQLNPLIGPQINVKTI 70

  Fly    72 AMIGRSWNN 80
            ..|...|.:
 Worm    71 RWISEKWGD 79

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 24/58 (41%)
vha-17NP_501636.2 ATP_synt_H 6..64 CDD:283211 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131313694
eggNOG 1 0.900 E1_KOG3500
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I3766
Isobase 1 0.950 0 Normalized mean entropy S2878
OMA 1 1.010
OrthoDB 1 1.010 D1613627at2759
OrthoFinder 1 1.000 FOG0001163
OrthoInspector 1 1.000 T375222
orthoMCL 1 0.900 OOG5_129204
Panther 1 1.100 LDO PTHR12263
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2893
TreeFam 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.