DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and atp6v0e1

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001165157.1 Gene:atp6v0e1 XenbaseID:XB-GENE-988748 Length:81 Species:Xenopus tropicalis

Alignment Length:72 Identity:27/73 (37%)
Similarity:44/73 (60%) Gaps:0/73 (0%)


  Fly     7 PVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVV 71
            |::..|..||.:|..:|...||||::.:|..:|:..:.||:||||...:||:|||.||:|..:.:
 Frog     9 PIIVMTVFWGFIGAILPWFIPKGPNRGVINTMLVTCSVCCYLFWLIAILAQLNPLFGPQLTSETI 73

  Fly    72 AMIGRSW 78
            ..:...|
 Frog    74 YYLKNHW 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 25/58 (43%)
atp6v0e1NP_001165157.1 ATP_synt_H 9..67 CDD:283211 25/58 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2308000
eggNOG 1 0.900 E1_KOG3500
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5001
OMA 1 1.010
OrthoDB 1 1.010 D1613627at2759
OrthoFinder 1 1.000 FOG0001163
OrthoInspector 1 1.000 T129314
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2893
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.