powered by:
Protein Alignment VhaM9.7-a and atp6v0e1
DIOPT Version :9
Sequence 1: | NP_001097499.1 |
Gene: | VhaM9.7-a / 38521 |
FlyBaseID: | FBgn0035521 |
Length: | 85 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001165157.1 |
Gene: | atp6v0e1 / 100216036 |
XenbaseID: | XB-GENE-988748 |
Length: | 81 |
Species: | Xenopus tropicalis |
Alignment Length: | 72 |
Identity: | 27/72 - (37%) |
Similarity: | 44/72 - (61%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 PVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVV 71
|::..|..||.:|..:|...||||::.:|..:|:..:.||:||||...:||:|||.||:|..:.:
Frog 9 PIIVMTVFWGFIGAILPWFIPKGPNRGVINTMLVTCSVCCYLFWLIAILAQLNPLFGPQLTSETI 73
Fly 72 AMIGRSW 78
..:...|
Frog 74 YYLKNHW 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
63 |
1.000 |
Domainoid score |
I10066 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
67 |
1.000 |
Inparanoid score |
I5171 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1613627at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001872 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm47853 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2893 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X1797 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 7.090 |
|
Return to query results.
Submit another query.