DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VhaM9.7-a and atp6v0e1

DIOPT Version :9

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a / 38521 FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001165157.1 Gene:atp6v0e1 / 100216036 XenbaseID:XB-GENE-988748 Length:81 Species:Xenopus tropicalis


Alignment Length:72 Identity:27/72 - (37%)
Similarity:44/72 - (61%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVV 71
            |::..|..||.:|..:|...||||::.:|..:|:..:.||:||||...:||:|||.||:|..:.:
 Frog     9 PIIVMTVFWGFIGAILPWFIPKGPNRGVINTMLVTCSVCCYLFWLIAILAQLNPLFGPQLTSETI 73

  Fly    72 AMIGRSW 78
            ..:...|
 Frog    74 YYLKNHW 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:398897 24/57 (42%)
atp6v0e1NP_001165157.1 ATP_synt_H 9..67 CDD:368469 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10066
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1613627at2759
OrthoFinder 1 1.000 - - FOG0001872
OrthoInspector 1 1.000 - - otm47853
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2893
SonicParanoid 1 1.000 - - X1797
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.