DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: VhaM9.7-a and atp6v0e2

Sequence 1:NP_001097499.1 Gene:VhaM9.7-a FlyBaseID:FBgn0035521 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001165046.1 Gene:atp6v0e2 XenbaseID:XB-GENE-5771814 Length:81 Species:Xenopus tropicalis

Alignment Length:72 Identity:33/73 (45%)
Similarity:48/73 (66%) Gaps:0/73 (0%)


  Fly     7 PVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFWLCCYMAQMNPLIGPKLKRDVV 71
            |::.||..||.:|||.|...||||::.:|..:|:.||.||::|||...:||:|||.||:||.|.:
 Frog     9 PMIIFTTFWGLIGIAAPWFVPKGPNRGVIITMLVTTAVCCYIFWLVAILAQLNPLFGPQLKNDTI 73

  Fly    72 AMIGRSW 78
            ..:...|
 Frog    74 WYVRFLW 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
VhaM9.7-aNP_001097499.1 ATP_synt_H 7..65 CDD:283211 29/58 (50%)
atp6v0e2NP_001165046.1 ATP_synt_H 9..67 CDD:310236 29/58 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C2300442
eggNOG 1 0.900 E1_KOG3500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1613627at2759
OrthoFinder 1 1.000 FOG0001163
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.600 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.