DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11586 and Zmat2

Sequence 1:NP_001261410.1 Gene:CG11586 FlyBaseID:FBgn0035520 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001129054.1 Gene:Zmat2 RGDID:1583592 Length:199 Species:Rattus norvegicus

Alignment Length:191 Identity:130/192 (68%)
Similarity:159/192 (83%) Gaps:7/192 (4%)


  Fly     7 DHRRKWDKNEYEKLAAERLLNQVAPKEEEPVQ---RENLKRRDYKVDLDSKLGKSVVINKNTPTS 68
            |.||||||:||||||.:||..:...|:.:|||   ||.|:.|||||||:|||||::||.|.||.|
  Rat    11 DFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLESKLGKTIVITKTTPQS 75

  Fly    69 QSGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMKVERSTVDQVKERFQQNKKKMEEKQKDY 133
            :.|||||||||||||||||||||||||||||||||||:|||||:||||:||:.||||||||||||
  Rat    76 EMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKMEEKQKDY 140

  Fly   134 ELERRLREAKEEEDRYKEHRKEKRKERKRKA-EDTDFESGGMPDDMAAIMGFSGFGGSKKN 193
            :.|.|::|.:|||::.|.::|||:||:||:| ||..||.   .|:|||:|||||||.:||:
  Rat   141 DFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEE---EDEMAAVMGFSGFGSTKKS 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11586NP_001261410.1 ZnF_U1 70..101 CDD:197732 30/31 (97%)
Zmat2NP_001129054.1 ZnF_U1 77..108 CDD:197732 30/31 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C229082774
eggNOG 1 0.900 E1_KOG4727
Hieranoid 1 1.000
Homologene 1 1.000 H5563
Inparanoid 1 1.050 265 1.000 Inparanoid score I2932
OMA 1 1.010
OrthoDB 1 1.010 D1626636at2759
OrthoFinder 1 1.000 FOG0004153
OrthoInspector 1 1.000 T1088855
orthoMCL 1 0.900 OOG5_128816
Panther 1 1.100 LDO PTHR45986
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.