DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11586 and zmat2

Sequence 1:NP_001261410.1 Gene:CG11586 FlyBaseID:FBgn0035520 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001005119.1 Gene:zmat2 XenbaseID:XB-GENE-1217476 Length:199 Species:Xenopus tropicalis

Alignment Length:190 Identity:127/191 (66%)
Similarity:158/191 (83%) Gaps:7/191 (4%)


  Fly     7 DHRRKWDKNEYEKLAAERLLNQVAPKEEEPVQ---RENLKRRDYKVDLDSKLGKSVVINKNTPTS 68
            |.||||||:|||:||.:|:..:...|:.:|:|   ||.|:.|||||||:|||||::||.|.||.|
 Frog    11 DFRRKWDKDEYEQLAQKRITEEREKKDGKPLQPIKRELLRHRDYKVDLESKLGKTIVITKTTPQS 75

  Fly    69 QSGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMKVERSTVDQVKERFQQNKKKMEEKQKDY 133
            :.|||||||||||||||||||||||||||||||||||:|||||:||||:||:.||||||||||||
 Frog    76 EMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKMEEKQKDY 140

  Fly   134 ELERRLREAKEEEDRYKEHRKEKRKERKRKA-EDTDFESGGMPDDMAAIMGFSGFGGSKK 192
            :.|.|::|.:|||::.:.::|||::|:|||| ||..||.   .|:|||:|||||||.|||
 Frog   141 DFEERMKELREEEEKARAYKKEKQREKKRKAEEDLGFEE---DDEMAAVMGFSGFGSSKK 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11586NP_001261410.1 ZnF_U1 70..101 CDD:197732 30/31 (97%)
zmat2NP_001005119.1 ZnF_U1 77..108 CDD:197732 30/31 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C229084221
eggNOG 1 0.900 E1_KOG4727
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5563
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1626636at2759
OrthoFinder 1 1.000 FOG0004153
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.