DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11586 and snu23

Sequence 1:NP_001261410.1 Gene:CG11586 FlyBaseID:FBgn0035520 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_593030.3 Gene:snu23 PomBaseID:SPAC22F3.11c Length:151 Species:Schizosaccharomyces pombe

Alignment Length:163 Identity:37/164 (23%)
Similarity:71/164 (43%) Gaps:28/164 (17%)


  Fly    36 PVQRENLKR--------RDYKVDLDSKLGKSVVINKNTPTSQSGGYYCNVCDCVVKDSINFLDHI 92
            |.:..|.|:        |..::|.:..:.|:.::.:.:.......:.|.                
pombe     7 PRRNGNSKKNEVVITGGRTQRIDFEKDVNKTTILPRWSFGRPKRPWSCT---------------- 55

  Fly    93 NGKKHQRNLGMSMKVERSTVDQVKERFQQNKKKMEEKQKDYELERRLREAKEEEDRYKEHRKEKR 157
               :|.|.....:..:|:|:::||||.:..::::.|.:|..| |..|:|..|...:..|.:|.:|
pombe    56 ---QHLRKTRTVIIEKRATLEEVKERMEYWRRQLLEPEKGSE-EYSLKERVERYHQELEAKKLRR 116

  Fly   158 KERKRKAEDTDFESGGMPDDMAAIMGFSGFGGS 190
            |::|...|.......|...::|||||.|.||.:
pombe   117 KQKKVNKEKNSPRLVGENTELAAIMGISSFGST 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11586NP_001261410.1 ZnF_U1 70..101 CDD:197732 3/31 (10%)
snu23NP_593030.3 P-loop_NTPase <72..>123 CDD:304359 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I1805
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004153
OrthoInspector 1 1.000 T1125821
orthoMCL 1 0.900 OOG5_128816
Panther 1 1.100 LDO PTHR45986
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1367
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.