DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and AT1G66900

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_176862.2 Gene:AT1G66900 AraportID:AT1G66900 Length:272 Species:Arabidopsis thaliana

Alignment Length:232 Identity:56/233 (24%)
Similarity:98/233 (42%) Gaps:46/233 (20%)


  Fly   204 GRAKLIE----DDNGIRYKVKTIDSNEIDTLFIDNRPNNVGNGKTLVICSEGNAG----FYEVGI 260
            ||..:.|    ||..| .|::|...|||..:::   .::..||..|.  |.|||.    .:|:.:
plant    32 GRLYIPEIPRRDDVDI-LKLRTRCGNEIVAVYV---KHSKANGTLLY--SHGNAADLGQMFELFV 90

  Fly   261 MATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDAVVQFAINNLRFPVED--IILYGWSIGGF 323
            ..:. .|:.:::|:::.|:..|||  ...:.....|....:.....::.|:|  :|:||.|:|..
plant    91 ELSN-RLRVNLMGYDYSGYGQSTG--QASECNTYADIEASYKCLKEKYGVKDDQLIVYGQSVGSG 152

  Fly   324 STLYAASVYPDVKGVVLDATFDDVLYLAVPRMPAALAGIVKVAIRNYCN-----LNNAELANEFN 383
            .|:..||..|:::||||....              |:| ::|.....|.     ..|.:......
plant   153 PTVDLASRTPNLRGVVLQCPI--------------LSG-MRVLYPVKCTYWFDIYKNIDKIGSVT 202

  Fly   384 GPISFIRRTEDEIIAEDNHIDTNRGNFLVLSVLKHRY 420
            .|:..|..|.||:      :|.:.|..| ..:.|.:|
plant   203 CPVLVIHGTADEV------VDWSHGKRL-WELSKEKY 232

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 28/117 (24%)
AT1G66900NP_176862.2 MhpC 62..258 CDD:223669 45/202 (22%)
Abhydrolase_5 71..243 CDD:289465 43/190 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12277
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.