DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and AT1G32190

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_174498.1 Gene:AT1G32190 AraportID:AT1G32190 Length:422 Species:Arabidopsis thaliana

Alignment Length:195 Identity:51/196 (26%)
Similarity:92/196 (47%) Gaps:27/196 (14%)


  Fly   219 VKTIDSNEIDTLFIDNRPNNVGNGKTLVICSEGNAGFYEVG-----IMATPVALKYSVLGWNHPG 278
            |||...|::...::.|     .|.:..::.|.|||.  ::|     .:...|.|:.:::|:::.|
plant    58 VKTRRGNKVTAFYLRN-----PNARLTLLYSHGNAA--DLGQLFDLFVQLKVNLRVNLMGYDYSG 115

  Fly   279 FAGSTGTPHPHQDKNAIDAVVQFAINNLRFPVEDIILYGWSIGGFSTLYAASVYPDVKGVVLDAT 343
            :..|||.|..:.....|:|..:....:.....||:||||.|:|...||:.||..|.::||||.: 
plant   116 YGASTGKPSEYDTYADIEAAYECLQTDYGVGQEDLILYGQSVGSGPTLHLASKLPRLRGVVLHS- 179

  Fly   344 FDDVLYLAVPRMPAALAGIVKVAIRNYCNL-NNAELANEFNGPISFIRRTEDEIIAEDNHIDTNR 407
              .:|        :.|..:..|..:..|:: :|.....:...|:..|..|||:::   |.:..||
plant   180 --GIL--------SGLRVLCHVKFKFCCDIYSNVNKIKKVKCPVLVIHGTEDDVV---NWLHGNR 231

  Fly   408  407
            plant   232  231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 33/116 (28%)
AT1G32190NP_174498.1 MhpC 66..268 CDD:223669 47/188 (25%)
Abhydrolase_5 79..251 CDD:289465 45/170 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12277
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.