DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and AT5G14390

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_196943.1 Gene:AT5G14390 AraportID:AT5G14390 Length:369 Species:Arabidopsis thaliana

Alignment Length:244 Identity:62/245 (25%)
Similarity:99/245 (40%) Gaps:41/245 (17%)


  Fly   187 PGSVKLLQK------LMRPMLISGRAKLIEDDNGIRYKVKTIDSNEIDTLFIDNRPNNVGNGKTL 245
            |.|.||:..      ||.|.......:::        |:.|....||..::: ..|    ...:.
plant    19 PSSYKLVYDELTGLLLMNPFPHRENVEIL--------KLPTRRGTEIVAMYV-RHP----MATST 70

  Fly   246 VICSEGNAG----FYEVGIMATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDAVVQFAINNL 306
            ::.|.|||.    .||:.|..: :.||.:::|:::.|:..|||.|..|.....|:|..:......
plant    71 LLYSHGNAADLGQMYELFIELS-IHLKVNLMGYDYSGYGQSTGKPSEHHTYADIEAAYKCLEETY 134

  Fly   307 RFPVEDIILYGWSIGGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPRMPAALAGIVKVAIRNYC 371
            ....|||||||.|:|...||..|:..|.::..||.:.....|.:..|........|.|       
plant   135 GAKQEDIILYGQSVGSGPTLDLAARLPQLRAAVLHSPILSGLRVMYPVKKTYWFDIFK------- 192

  Fly   372 NLNNAELANEFNGPISFIRRTEDEIIAEDNHIDTNRGNFLVLSVLKHRY 420
            |::...|.   |.|:..|..|.||:      :|.:.|..| ..:.|.:|
plant   193 NIDKIPLV---NCPVLVIHGTCDEV------VDCSHGKQL-WELSKEKY 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 35/115 (30%)
AT5G14390NP_196943.1 MhpC 61..261 CDD:223669 51/195 (26%)
Abhydrolase_5 70..242 CDD:289465 50/181 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12277
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.