DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1309 and AT4G31020

DIOPT Version :9

Sequence 1:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_194831.3 Gene:AT4G31020 / 829229 AraportID:AT4G31020 Length:294 Species:Arabidopsis thaliana


Alignment Length:210 Identity:54/210 - (25%)
Similarity:87/210 - (41%) Gaps:45/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 VICSEGNAGFYEVGIMA-----TPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDAVVQFAINN 305
            ::.|.|||.  ::|.|.     ....|:.:::.:::.|:..|||.|........|:||.....::
plant    71 LLYSHGNAA--DLGQMVELFIELRAHLRVNIMSYDYSGYGASTGKPSEFNTYYDIEAVYSCLRSD 133

  Fly   306 LRFPVEDIILYGWSIGGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPRMPAALAGI-----VKV 365
            .....|:|||||.|:|...||:.||....::||||.:              |.|:||     ||:
plant   134 YGIKQEEIILYGQSVGSGPTLHMASRLKRLRGVVLHS--------------AILSGIRVLYPVKM 184

  Fly   366 AIRNYCNLNNAELANEFNGPISFIRRTEDEIIAEDNHIDTNRGNFLVLSVLKHRYPNIF--GASQ 428
            .:. :....|.:.....|..:..|..|.|||      :|.:.|..| ..:.|.:|..::  |...
plant   185 TLW-FDIFKNIDKIRHVNSQVLVIHGTNDEI------VDLSHGKRL-WELAKEKYDPLWVKGGGH 241

  Fly   429 LNKAKGLLSKPLEPY 443
            .|         ||.|
plant   242 CN---------LETY 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 31/114 (27%)
AT4G31020NP_194831.3 FrsA <70..259 CDD:223999 54/210 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12277
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.