DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and AT4G31020

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_194831.3 Gene:AT4G31020 AraportID:AT4G31020 Length:294 Species:Arabidopsis thaliana

Alignment Length:210 Identity:54/211 (26%)
Similarity:87/211 (41%) Gaps:45/211 (21%)


  Fly   246 VICSEGNAGFYEVGIMA-----TPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDAVVQFAINN 305
            ::.|.|||.  ::|.|.     ....|:.:::.:::.|:..|||.|........|:||.....::
plant    71 LLYSHGNAA--DLGQMVELFIELRAHLRVNIMSYDYSGYGASTGKPSEFNTYYDIEAVYSCLRSD 133

  Fly   306 LRFPVEDIILYGWSIGGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPRMPAALAGI-----VKV 365
            .....|:|||||.|:|...||:.||....::||||.:              |.|:||     ||:
plant   134 YGIKQEEIILYGQSVGSGPTLHMASRLKRLRGVVLHS--------------AILSGIRVLYPVKM 184

  Fly   366 AIRNYCNLNNAELANEFNGPISFIRRTEDEIIAEDNHIDTNRGNFLVLSVLKHRYPNIF--GASQ 428
            .:. :....|.:.....|..:..|..|.|||      :|.:.|..| ..:.|.:|..::  |...
plant   185 TLW-FDIFKNIDKIRHVNSQVLVIHGTNDEI------VDLSHGKRL-WELAKEKYDPLWVKGGGH 241

  Fly   429 LNKAKGLLSKPLEPY 443
            .|         ||.|
plant   242 CN---------LETY 247

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 31/115 (27%)
AT4G31020NP_194831.3 MhpC 70..260 CDD:223669 54/211 (26%)
Abhydrolase_5 70..242 CDD:289465 50/195 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12277
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.