DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and AT4G24760

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_194207.1 Gene:AT4G24760 AraportID:AT4G24760 Length:365 Species:Arabidopsis thaliana

Alignment Length:286 Identity:62/287 (22%)
Similarity:112/287 (39%) Gaps:60/287 (21%)


  Fly   207 KLIEDDNGIRYKVKTIDSNE-IDTLFIDNR------------PNNVGNGKTLVICSEGNAG---- 254
            ||:.|:....:.:......| :|.|.:..|            |..|    |.::.|.|||.    
plant    23 KLVRDETTELFLMSPFPHRENVDILRLPTRRGTEIVAMYIRYPMAV----TTLLYSHGNAADIGQ 83

  Fly   255 FYEVGIMATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDAVVQFAINNLRFPVEDIILYGWS 319
            .||:.|..: :.|:.:::|:::.|:..|:|.|........|:|..:....|.....|:|||||.|
plant    84 MYELFIELS-IHLRVNLMGYDYSGYGQSSGKPTEQNTYADIEAAYKCLEENYGAKQENIILYGQS 147

  Fly   320 IGGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPRMPAALAGI-VKVAIRN------YCNLNNAE 377
            :|...|:..|:..|.::..:|.:..              |:|: |...::.      |.|::...
plant   148 VGSGPTVDLAARLPRLRASILHSPI--------------LSGLRVMYPVKRTYWFDIYKNIDKIT 198

  Fly   378 LANEFNGPISFIRRTEDEIIAEDNHIDTNRGNFLVLSVLKHRYPNIFGASQLNKAKGLLSKPLEP 442
            |.   ..|:..|..|.|::      :|.:.|..| ..:.:.:|..::       .||.....||.
plant   199 LV---RCPVLVIHGTADDV------VDFSHGKQL-WELCQEKYEPLW-------LKGGNHCDLEL 246

  Fly   443 YSIPVADEKLCMSRLITYASDEGKSF 468
            :...:...|..:|.:...||....||
plant   247 FPEYIGHLKKFVSAVEKSASKRNSSF 272

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 28/115 (24%)
AT4G24760NP_194207.1 MhpC 61..261 CDD:223669 51/236 (22%)
Abhydrolase_5 70..242 CDD:289465 44/204 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12277
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.