DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and AT3G30380

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_189657.1 Gene:AT3G30380 AraportID:AT3G30380 Length:399 Species:Arabidopsis thaliana

Alignment Length:207 Identity:50/208 (24%)
Similarity:91/208 (44%) Gaps:28/208 (13%)


  Fly   201 LISGRAKLIEDDNGIR-----YKVKTIDSNEIDTLFIDNRPNNVGNGKTLVICSEGNAGFYEVGI 260
            ::.|:.:||..:| ::     .|:||...|::...:|.|     ......::.|.|||.  ::|.
plant    26 VVEGKLRLIGVEN-VKENVEVLKLKTKRGNQVVAAYIKN-----PTASLTLLYSHGNAA--DLGQ 82

  Fly   261 M-----ATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDAVVQFAINNLRFPVEDIILYGWSI 320
            |     ...:.|:.:::|:::.|:..|:|.|......:.|:||.:..........:|:||||.|:
plant    83 MFELFSELSLHLRVNLIGYDYSGYGRSSGKPSEQNTYSDIEAVYRCLEEKYGVKEQDVILYGQSV 147

  Fly   321 GGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPRMPAALAGIVKVAIRNYCNLNNAELANEFNGP 385
            |...||..||..|:::.|||.:.....|.:..|........|.|          |.|..:....|
plant   148 GSGPTLELASRLPNLRAVVLHSAIASGLRVMYPVKRTYWFDIYK----------NVEKISFVKCP 202

  Fly   386 ISFIRRTEDEII 397
            :..|..|.|:::
plant   203 VLVIHGTSDDVV 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 32/116 (28%)
AT3G30380NP_189657.1 MhpC 69..260 CDD:223669 40/159 (25%)
Abhydrolase_5 69..241 CDD:289465 40/159 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12277
Phylome 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.