DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and ABHD16A

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_066983.1 Gene:ABHD16A HGNCID:13921 Length:558 Species:Homo sapiens

Alignment Length:560 Identity:233/561 (42%)
Similarity:323/561 (58%) Gaps:54/561 (10%)


  Fly     4 LNYVFGPNLYMEYR---------GVPEPQRKM-----------YEAGAVEKFGEQILSTLSVMWS 48
            |:.|.||.||..||         .|||....:           |:..|:||..:.||:..||.||
Human     5 LSCVLGPRLYKIYRERDSERAPASVPETPTAVTAPHSSSWDTYYQPRALEKHADSILALASVFWS 69

  Fly    49 VGYYTSPLLVTFLYRRGYLVTDSIPTLAKITTSVGLIVILSLVMRGLGR---KQSRSYSNMIKAL 110
            :.||:||....:|||:|||....:...:....::.|::.....:||:||   .|.|.:..:::|.
Human    70 ISYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLLLLAGVACLRGIGRWTNPQYRQFITILEAT 134

  Fly   111 VRAKSSKAPGDANSELRRFDIEFNAWPVDF------DVKALTGDTKKPVVTARRREPIQLAT--- 166
            .|.:||    :...:|..::.:|.:|||||      ..|...|...:..|...|.||:...|   
Human   135 HRNQSS----ENKRQLANYNFDFRSWPVDFHWEEPSSRKESRGGPSRRGVALLRPEPLHRGTADT 195

  Fly   167 -------LPCEAIAYLAINTFGLSMIYPGSVKLLQKLMRPMLISGRAKLIEDDNGIRYKVKTIDS 224
                   |||:..:||..:|.|..|:|||||.||||.:.|:|:.|:|:|:|:.||.|.|:...|.
Human   196 LLNRVKKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDG 260

  Fly   225 NEIDTLFIDNRPNNVGNGKTLVICSEGNAGFYEVGIMATPVALKYSVLGWNHPGFAGSTGTPHPH 289
            |||||:|:|.|......|:.||||.||||||||||.::||:...||||||||||||||||.|.|.
Human   261 NEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQ 325

  Fly   290 QDKNAIDAVVQFAINNLRFPVEDIILYGWSIGGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPR 354
            .:.||:|.||||||:.|.|..:|||:|.||||||:..:||..||||..::|||:|||::.||:..
Human   326 NEANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFTATWAAMSYPDVSAMILDASFDDLVPLALKV 390

  Fly   355 MPAALAGIVKVAIRNYCNLNNAELANEFNGPISFIRRTEDEIIA----EDNHIDTNRGNFLVLSV 415
            ||.:..|:|...:|.:.||||||....:.||:..||||:||||.    ||  |.:||||.|:|.:
Human   391 MPDSWRGLVTRTVRQHLNLNNAEQLCRYQGPVLLIRRTKDEIITTTVPED--IMSNRGNDLLLKL 453

  Fly   416 LKHRYPNIFGASQLNKAKGLL--SKPLEP---YSIPVADEKLCMSRLITYASDEGKSFPMNIGAD 475
            |:||||.:.....|...:..|  |..||.   ||....:|..|:|.|.:|.::.|..||.::|.|
Human   454 LQHRYPRVMAEEGLRVVRQWLEASSQLEEASIYSRWEVEEDWCLSVLRSYQAEHGPDFPWSVGED 518

  Fly   476 YSEEVRNLMAVFLLRKHLRDYNSTHCTQLPGEFFTMPWDI 515
            .|.:.|..:|:||.||||.::.:||||.||.:.|.|||.:
Human   519 MSADGRRQLALFLARKHLHNFEATHCTPLPAQNFQMPWHL 558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 70/111 (63%)
ABHD16ANP_066983.1 Abhydrolase_1 280..>408 CDD:331148 74/128 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93376312
eggNOG 1 0.900 E1_KOG1553
Hieranoid 1 1.000
Homologene 1 1.000 H10904
Inparanoid 1 1.050 412 1.000 Inparanoid score I1840
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D264054at33208
OrthoFinder 1 1.000 FOG0003470
OrthoInspector 1 1.000 T610232
orthoMCL 1 0.900 OOG5_132890
Panther 1 1.100 LDO PTHR12277
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2935
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.