DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and abhd16a

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001104648.1 Gene:abhd16a ZFINID:ZDB-GENE-010601-2 Length:543 Species:Danio rerio

Alignment Length:545 Identity:222/546 (41%)
Similarity:320/546 (59%) Gaps:35/546 (6%)


  Fly     1 MSFLNYVFGPNLYMEYRGVPEPQRK---------MYEAGAVEKFGEQILSTLSVMWSVGYYTSPL 56
            :.:|..:.||||...:|. |:..|.         .|:...:|:..:.||...||:||:.||||||
Zfish     4 LMWLRCILGPNLQRIHRS-PDQTRTDGRSARRGWNYQPRGLERHTDSILGWASVLWSLSYYTSPL 67

  Fly    57 LVTFLYRRGYLVTDSIPTLAKITTSVGLIVILSLV-MRGLGRKQSRSYSNMIKALVRAKSSKAPG 120
            |:.:|||:||:.:..:..|::. ....|:.:|.:. :||.||.::..|...|..|...:::....
Zfish    68 LLCYLYRKGYICSSKLVPLSQY-VGTALVCLLGVACLRGWGRWRNPEYLQFISILEETRNNHTTN 131

  Fly   121 DANSELRRFDIEFNAWPVDFDVKALTG-DTKKPVVTARRREP----------IQLATLPCEAIAY 174
            : ..:|..||.:|..||.||..|.::. .:.|..|:..|.||          ..:.||||..::|
Zfish   132 N-KKKLACFDFDFKHWPADFSWKDVSSPKSSKGGVSLLRPEPKHRGAADTVLSSVRTLPCHILSY 195

  Fly   175 LAINTFGLSMIYPGSVKLLQKLMRPMLISGRAKLIEDDNGIRYKVKTIDSNEIDTLFIDNRPNNV 239
            ...::||..|:|||||.||||.|||||..|:|:|:|:..|.|.|:...|.|||||:|:|.|.:..
Zfish   196 AIAHSFGRRMLYPGSVGLLQKAMRPMLQQGQARLVEEYEGQRNKLVACDGNEIDTMFVDRRRDGG 260

  Fly   240 GNGKTLVICSEGNAGFYEVGIMATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDAVVQFAIN 304
            ..|||||||.||||||||||.|.||:...|||||||||||.||||.|.|..:.||:|.|:|||::
Zfish   261 TAGKTLVICCEGNAGFYEVGCMNTPLEGGYSVLGWNHPGFGGSTGVPFPQNEANAMDVVIQFAVH 325

  Fly   305 NLRFPVEDIILYGWSIGGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPRMPAALAGIVKVAIRN 369
            .|.|.:.|||:|.||||||:..:|...||:::.:||||:|||:|.||:..||.:...:|...:|.
Zfish   326 KLGFQLRDIIVYAWSIGGFTASWAVMSYPEIRALVLDASFDDLLPLALKVMPDSWRPLVTHTVRQ 390

  Fly   370 YCNLNNAELANEFNGPISFIRRTEDEIIA----EDNHIDTNRGNFLVLSVLKHRYPNIFGASQLN 430
            |.||||||...::.||:..||||.||||.    ||  |.:||||.|:|.:|::|||.:.....:.
Zfish   391 YMNLNNAEQLCKYQGPVLLIRRTRDEIITTTGPED--IMSNRGNDLLLRLLQYRYPKVMTDDAVT 453

  Fly   431 KAKGLLS--KPLEPYSIPV---ADEKLCMSRLITYASDEGKSFPMNIGADYSEEVRNLMAVFLLR 490
            ..:..|:  ..:|..|:..   .|:..|:|.|.:|.:|....||.::|.|.:.|.|..:.:||.|
Zfish   454 AVRRWLAAGTQIEEESVYTGYEVDDDWCLSVLQSYQTDRETLFPWSVGEDMTLEGRRQLGLFLAR 518

  Fly   491 KHLRDYNSTHCTQLPGEFFTMPWDI 515
            |::|::.:||||.||...|..||.:
Zfish   519 KYMRNFETTHCTPLPISEFRPPWKL 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 67/111 (60%)
abhd16aNP_001104648.1 Abhydrolase_5 289..419 CDD:289465 70/130 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93370547
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H10904
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D264054at33208
OrthoFinder 1 1.000 FOG0003470
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_132890
Panther 1 1.100 LDO PTHR12277
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.