DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and si:ch211-117n7.6

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_021328354.1 Gene:si:ch211-117n7.6 ZFINID:ZDB-GENE-060503-474 Length:344 Species:Danio rerio

Alignment Length:144 Identity:37/145 (26%)
Similarity:64/145 (44%) Gaps:34/145 (23%)


  Fly   239 VGNGKTLVICSEGNAG----FYEVGIMATPVALKYSVLGWNHPGFAGSTGTP-HPHQDKNAI--- 295
            :|:|..:.|...||.|    .:.:|:.....||.|.||..::.||..|||.| .|....:|:   
Zfish   113 LGDGSPIFIYLHGNGGNRSALHRIGVANVLSALGYHVLVMDYRGFGDSTGEPTEPGLTTDALYLY 177

  Fly   296 DAVVQFAINNLRFPVEDIILYGWSIG-GFSTLYAASVYPDVK---GVVLDATFDDVLYLAVPRMP 356
            :.:.:.:.|:|      :.::|.||| |.:|..|..:..:.|   |::|:.              
Zfish   178 NWIKKRSGNSL------VCVWGHSIGSGVTTNVAVKLLEEGKKFDGIILEG-------------- 222

  Fly   357 AALAGIVKVAIRNY 370
            |.|:|  :.|.:.|
Zfish   223 AMLSG--RAAAKQY 234

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 30/123 (24%)
si:ch211-117n7.6XP_021328354.1 AXE1 77..>171 CDD:331847 19/58 (33%)
Abhydrolase_1 138..316 CDD:331148 30/120 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93683591
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.