DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and abhd16a

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001006774.2 Gene:abhd16a XenbaseID:XB-GENE-480044 Length:572 Species:Xenopus tropicalis

Alignment Length:549 Identity:215/550 (39%)
Similarity:320/550 (58%) Gaps:43/550 (8%)


  Fly     7 VFGPNLYMEY-----------RGVPEPQ-----RKMYEAGAVEKFGEQILSTLSVMWSVGYYTSP 55
            |.||.||..|           ||..|.:     ...|:..|:||..:.||:.:||:|::.||:||
 Frog    27 VKGPRLYRVYRQNGRTAAIRGRGQEEEEPGVSWESFYQPRALEKHTDSILAWVSVLWTISYYSSP 91

  Fly    56 LLVTFLYRRGYLVTDSIPTLAKITTSVGLIVILSLVMRGLGRKQSRSYSNMIKALVRAKSSKAPG 120
            |.:.::||:|||....:..|.:...:..|::...:.:||:||..:..|...|..|.|.|....| 
 Frog    92 LAICYMYRKGYLNMSRLVPLGQYGLTFLLLLAGVVCLRGIGRWSNPHYIQFIYILERTKIENNP- 155

  Fly   121 DANSELRRFDIEFNAWPVDF--------DVKA---------LTGDTKKPVVTARRREPIQLATLP 168
            :....|..::.:|::|||||        |:|:         |..|.:....|....:.||  .||
 Frog   156 ENKKLLSSYNFDFHSWPVDFQWNEASSKDLKSTGPLGGVPLLKPDPRPRGTTDNVLQRIQ--KLP 218

  Fly   169 CEAIAYLAINTFGLSMIYPGSVKLLQKLMRPMLISGRAKLIEDDNGIRYKVKTIDSNEIDTLFID 233
            |:..:|...::||..|:|||||.||||.:.|||:.|:|:|:|:.||.|.|:...|.|||||:|:|
 Frog   219 CQITSYAVAHSFGRRMLYPGSVYLLQKALMPMLLQGQARLVEEYNGRRAKLLACDGNEIDTIFVD 283

  Fly   234 NRPNNVGNGKTLVICSEGNAGFYEVGIMATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDAV 298
            .|......|..||||.||||||||:|.::||:...||||||||||||||||.|.|..:.||:|.|
 Frog   284 RRHLGDNKGAKLVICCEGNAGFYEIGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVV 348

  Fly   299 VQFAINNLRFPVEDIILYGWSIGGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPRMPAALAGIV 363
            :|:|:..|.|.::|||:|.||||||:..:||..|||:..:||||:|||::.||:..||.:..|:|
 Frog   349 IQYALYKLGFQLQDIIVYAWSIGGFTATWAAMSYPDLSAIVLDASFDDLVPLALKVMPESWRGLV 413

  Fly   364 KVAIRNYCNLNNAELANEFNGPISFIRRTEDEIIAE--DNHIDTNRGNFLVLSVLKHRYPNIFGA 426
            ...:|.|.||||||....:.||:..||||:||||..  .:.:.:||||.|::::|:.|||.:...
 Frog   414 TRTVRKYLNLNNAEQLCRYQGPVLLIRRTKDEIITTTLPDDVSSNRGNDLLMALLQQRYPKVMSE 478

  Fly   427 SQLNKAKGLL--SKPLEPYSIPV---ADEKLCMSRLITYASDEGKSFPMNIGADYSEEVRNLMAV 486
            ......:..|  |.|.:..|:..   .::..|:|.|.:|.|:....||.::|.|.|.|.|..:|:
 Frog   479 EGRRVVREWLACSTPEQEASVQSHYGVEDDWCLSVLQSYQSEHTGLFPWSVGEDMSSEGRKQLAL 543

  Fly   487 FLLRKHLRDYNSTHCTQLPGEFFTMPWDI 515
            :|.:::|:::.:|||:.||..:|.|||.:
 Frog   544 YLAQRYLKNFEATHCSPLPASYFHMPWKL 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 66/111 (59%)
abhd16aNP_001006774.2 Abhydrolase_5 316..448 CDD:289465 72/132 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93375609
eggNOG 1 0.900 E1_KOG1553
Hieranoid 1 1.000
Homologene 1 1.000 H10904
Inparanoid 1 1.050 393 1.000 Inparanoid score I1823
OMA 1 1.010
OrthoDB 1 1.010 D264054at33208
OrthoFinder 1 1.000 FOG0003470
OrthoInspector 1 1.000 T1061257
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2935
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.