DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and Bem46

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_477372.1 Gene:Bem46 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster

Alignment Length:191 Identity:40/192 (21%)
Similarity:74/192 (39%) Gaps:13/192 (7%)


  Fly   215 IRYKVKTIDSNEIDTLFIDNRPNNVGNGKTLVICSEGNAGFYEVGIMATPV-----ALKYSVLGW 274
            |...:||.|...:...:: .:|.........::...||||  .:|.....|     .|..:||..
  Fly    81 ITVSIKTPDDVTLHAFWV-TQPEERSKSSPTLLYFHGNAG--NMGHRMQNVWGIYHHLHCNVLMV 142

  Fly   275 NHPGFAGSTGTPHPHQDKNAIDAVVQFAINNLRFPVEDIILYGWSIGGFSTLYAA--SVY-PDVK 336
            .:.|:..|||.|..........|.:.:...........:||:|.|:||...:..|  :|| ..:.
  Fly   143 EYRGYGLSTGVPTERGLVTDARAAIDYLHTRHDLDHSQLILFGRSLGGAVVVDVAADTVYGQKLM 207

  Fly   337 GVVLDATFDDVLYLAVPRMPAALAGIVKVAIRNYCNLNNAELANEFNGPISFIRRTEDEII 397
            ..:::.||..:..:||..:..|:..|..:..:|  ..::.....:.:.|..||....|.::
  Fly   208 CAIVENTFSSIPEMAVELVHPAVKYIPNLLFKN--KYHSMSKIGKCSVPFLFISGLADNLV 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 28/119 (24%)
Bem46NP_477372.1 FrsA 72..305 CDD:223999 40/192 (21%)
Abhydrolase_5 110..294 CDD:289465 35/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93356024
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12277
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.