DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1309 and CG15111

DIOPT Version :9

Sequence 1:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_725856.1 Gene:CG15111 / 37200 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster


Alignment Length:246 Identity:58/246 - (23%)
Similarity:93/246 - (37%) Gaps:63/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 GKTLVICSEGNAGFYEVG----IMATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDA--VVQ 300
            |.|:|:...||......|    :......|.|.|..:::.|:|.|...| |.::....||  |.:
  Fly   180 GGTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVP-PTEEGVVRDAMMVFE 243

  Fly   301 FAINNLRFPVEDIILYGWSIG-GFSTLYAASV------YPDVKGVVLDATFDDV----------- 347
            :..|....|   |:::|.|:| |.:|...|.:      .|  :||:|::.|.::           
  Fly   244 YIANTTSNP---IVVWGHSLGTGVATHLCAKLASLRERAP--RGVILESPFTNIRDEIRMHPFAK 303

  Fly   348 LYLAVPRMPAALAGIVKVAIRNYCNLNNAELANEFNGPISFIRRTEDEIIAEDNHIDTNRGNFLV 412
            ||..:|.....::   :....|.....:.....||..||..| ..||:::     :..|.|..|.
  Fly   304 LYKNLPWFNFTIS---QPMYTNRLRFESDVHVLEFRQPIMII-HAEDDVV-----VPFNLGYRLY 359

  Fly   413 LSVLK-----------HRYPNIFGASQLNKAK---------GLLSKPLEPY 443
            ...|.           ||    ||||:....|         ||:.|.:|.|
  Fly   360 RIALDGRSRTSGPVEFHR----FGASRKYGHKYLCRAPELPGLIQKFVENY 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 32/134 (24%)
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 48/216 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12277
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.