DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and CG15111

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_725856.1 Gene:CG15111 FlyBaseID:FBgn0034419 Length:411 Species:Drosophila melanogaster

Alignment Length:246 Identity:58/247 (23%)
Similarity:93/247 (38%) Gaps:63/247 (26%)


  Fly   242 GKTLVICSEGNAGFYEVG----IMATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDA--VVQ 300
            |.|:|:...||......|    :......|.|.|..:::.|:|.|...| |.::....||  |.:
  Fly   180 GGTVVLYLHGNTASRGSGHRSEVYKLLRKLNYHVFSFDYRGYADSDPVP-PTEEGVVRDAMMVFE 243

  Fly   301 FAINNLRFPVEDIILYGWSIG-GFSTLYAASV------YPDVKGVVLDATFDDV----------- 347
            :..|....|   |:::|.|:| |.:|...|.:      .|  :||:|::.|.::           
  Fly   244 YIANTTSNP---IVVWGHSLGTGVATHLCAKLASLRERAP--RGVILESPFTNIRDEIRMHPFAK 303

  Fly   348 LYLAVPRMPAALAGIVKVAIRNYCNLNNAELANEFNGPISFIRRTEDEIIAEDNHIDTNRGNFLV 412
            ||..:|.....::   :....|.....:.....||..||..| ..||:::     :..|.|..|.
  Fly   304 LYKNLPWFNFTIS---QPMYTNRLRFESDVHVLEFRQPIMII-HAEDDVV-----VPFNLGYRLY 359

  Fly   413 LSVLK-----------HRYPNIFGASQLNKAK---------GLLSKPLEPY 443
            ...|.           ||    ||||:....|         ||:.|.:|.|
  Fly   360 RIALDGRSRTSGPVEFHR----FGASRKYGHKYLCRAPELPGLIQKFVENY 406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 32/135 (24%)
CG15111NP_725856.1 Abhydrolase_5 183..381 CDD:289465 49/217 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93392403
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12277
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.