DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and Abhd16a

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:XP_017172840.1 Gene:Abhd16a MGIID:99476 Length:584 Species:Mus musculus

Alignment Length:586 Identity:228/587 (39%)
Similarity:321/587 (55%) Gaps:80/587 (14%)


  Fly     4 LNYVFGPNLYMEYR---------GVPEPQRKM-----------YEAGAVEKFGEQILSTLSVMWS 48
            |:.|.||.||..||         .|||....:           |:..|:||..:.||:..||.||
Mouse     5 LSCVLGPRLYKIYRERDTDRAASSVPETPTAVPAASSSSWDTYYQPRALEKHADSILALASVFWS 69

  Fly    49 VGYYTSPLLVTFLYRRGYLVTDSIPTLAKITTSVGLIVILSLVMRGLGR---KQSRSYSNMIKAL 110
            :.||:||....:|||:|||....:...:....::.|::.....:||:||   .|.|.:..:::|.
Mouse    70 ISYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLLLLAGVACLRGIGRWTNPQYRQFITILEAT 134

  Fly   111 VRAKSSKAPGDANSELRRFDIEFNAWPVDF------DVKALTGDTKKPVVTARRREPIQLAT--- 166
            .|.:|:    :...:|..::.:|.:|||||      ..|...|...:..|...|.||:...|   
Mouse   135 HRNQSA----ENKRQLANYNFDFRSWPVDFHWEEPSSRKGSRGGPSRRGVALLRPEPLHRGTADT 195

  Fly   167 -------LPCEAIAYLAINTFGLSMIYPGSVKLLQKLMRPMLISGRAKLIEDDNGIRYKVKTIDS 224
                   |||:..:||..:|.|..|:|||||.||||.:.|:|:.|:|:|:|:.||.|.|:...|.
Mouse   196 FLNRVKKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDG 260

  Fly   225 NEIDTLFIDNRPNNVGNGKTLVICSEGNAGFYEVGIMATPVALKYSVLGWNHPGFAGSTGTPHPH 289
            |||||:|:|.|......|:.||||.||||||||||.::||:...||||||||||||||||.|.|.
Mouse   261 NEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQ 325

  Fly   290 QDKNAIDAVVQFAINNLRFPVEDIILYGWSIGGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPR 354
            .:.||:|.||||||:.|.|..:||::|.||||||:..:||..|||:..|:|||:|||::.||:..
Mouse   326 NEANAMDVVVQFAIHRLGFQPQDIVIYAWSIGGFTATWAAMSYPDISAVILDASFDDLVPLALKV 390

  Fly   355 MPAALAGIVKVAIRNYCNLNNAELANEFNGPISFIRRTEDEIIA----EDNHIDTNRGNFLVLSV 415
            ||.:...:|...:|.:.||||:|....|.||:..:|||:||||.    ||  |.:||||.|:|.:
Mouse   391 MPDSWRALVTRTVRQHLNLNNSEQLCRFQGPVLLVRRTKDEIITTTVPED--IMSNRGNDLLLKL 453

  Fly   416 LKHRYPNIFGASQLNKAKGLL--SKPLEP---YSIPVADEKLCMSRLITYASDEGKSFPMNI--- 472
            |:.|||.:.....|...:..|  |..||.   ||....:|..|:|.|.:|.::.|..||.::   
Mouse   454 LQFRYPRVMVEEGLRAVRQWLEASSQLEEASIYSRWEVEEDWCVSVLRSYQAEHGPDFPWSVGKD 518

  Fly   473 -----------------------GADYSEEVRNLMAVFLLRKHLRDYNSTHCTQLPGEFFTMPWD 514
                                   |.|.|.:.|..:|:||.||||.::.:||||.||.:.|.|||.
Mouse   519 GVEGWEERKDVPGRDLRASSPCAGEDMSADGRRQLALFLARKHLHNFEATHCTPLPAQHFQMPWH 583

  Fly   515 I 515
            :
Mouse   584 L 584

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 69/111 (62%)
Abhd16aXP_017172840.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93375896
eggNOG 1 0.900 E1_KOG1553
Hieranoid 1 1.000
Homologene 1 1.000 H10904
Inparanoid 1 1.050 406 1.000 Inparanoid score I1873
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D264054at33208
OrthoFinder 1 1.000 FOG0003470
OrthoInspector 1 1.000 T617038
orthoMCL 1 0.900 OOG5_132890
Panther 1 1.100 LDO PTHR12277
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2935
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.