DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and F37A4.1

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_498475.1 Gene:F37A4.1 WormBaseID:WBGene00018131 Length:482 Species:Caenorhabditis elegans

Alignment Length:538 Identity:182/539 (34%)
Similarity:269/539 (50%) Gaps:91/539 (17%)


  Fly     2 SFLNYVFGPNLYMEYRGVPEPQRKMYEAGAVEKFGEQILSTLSVMWSVG-YYTS------PLLVT 59
            ||...:.||.||..: |.|..|..     .:|..|..::|     :|.| ||.:      |:::.
 Worm     3 SFWTQISGPRLYGIF-GQPNRQEP-----TLENLGNTVIS-----FSAGIYYIASSLAFGPVILC 56

  Fly    60 FLYRRGYLVTDSIPTLAKITTSVGLIVILSLVMRGLGRKQSRSYSNMIKALVRAKSSKAPGDANS 124
            :||.|.:|....:.|:.|.   .|.:.::....|..||....:.|..:......|:.|   |.||
 Worm    57 YLYSRDWLTPAGMLTILKY---AGYLTLIGYGARTFGRLFDETNSRFLDIWENEKNKK---DDNS 115

  Fly   125 E--LRRFDIE-------FNAWPVDFDVKALTGDTKKPVVTARRREPIQLATLPCEAIAYLAINTF 180
            .  |:::|.|       |.|.| :.|:..|..:..:..|..|             .:|..||:.|
 Worm   116 HAALKKYDFELLDVIPDFVARP-NSDLWHLKPEVAEAGVVTR-------------GLASWAIHAF 166

  Fly   181 GLSMIYPGSVKLLQKLMRPMLISGRAKLIEDDNGIRYKVKTIDSNEIDTLFIDNRPNNVGNGKTL 245
            |..:|||||:.||:.:|||.|.:.|..|:::.||.|..:|:.:.:.:|.:|:    ......:.|
 Worm   167 GRHLIYPGSMALLKYMMRPNLNAARKLLVQNKNGQRLWIKSSEGDTLDAMFL----RGTNQSQDL 227

  Fly   246 VICSEGNAGFYEVGIMATPVALKYSVLGWNHPGFAGSTGTPHPHQDKNAIDAVVQFAINNLRFPV 310
            :||.||||||||:|:|.:|..|.|:.||:|.|||..|||.|:......|.|||:|:||..|.:..
 Worm   228 IICFEGNAGFYEIGVMNSPAQLGYTTLGFNLPGFGESTGLPYAVNTLAAADAVMQYAIQVLGYRQ 292

  Fly   311 EDIILYGWSIGGFSTLYAASVYPDVKGVVLDATFDDVLYLAVPRMPAALAGIVKVAIRNYCNLNN 375
            |:|:|:|||||||...:.||.||:||.|||||||||:|.||:.|||...:.||:.||||:.||..
 Worm   293 ENIVLFGWSIGGFPVAWLASNYPNVKAVVLDATFDDLLPLALFRMPTFFSTIVEHAIRNHMNLQI 357

  Fly   376 AELANEFNGPISFIRRTEDEII--AEDNHID-----TNRGNFLVLSVLKHRYPNIFGASQLNKAK 433
            .:|...:.|||..|||.::||:  |.|:..:     |||.|:|:.|::|.|:|.           
 Worm   358 DKLLARYKGPIRLIRRLQEEILTTAVDDQPENVRRATNRINWLLKSIIKDRHPE----------- 411

  Fly   434 GLLSKPLEPYSIPVADEKLCMS---RLITYASDEGKSFPMNIGADYSEEVRNLMAVFLLRKH-LR 494
              |.:.|||.    .|..|.|:   ||            |:.|....||......:|....| |.
 Worm   412 --LIQNLEPQ----VDRWLDMTPTERL------------MHSGVSLREESTQRKRLFDACNHYLI 458

  Fly   495 DYNSTHCTQLPGEFFTMP 512
            |:::.|.|.|..::|.:|
 Worm   459 DFDANHVTPLDPQYFNIP 476

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 64/111 (58%)
F37A4.1NP_498475.1 Abhydrolase_1 226..462 CDD:278959 110/265 (42%)
Abhydrolase_5 247..>341 CDD:289465 51/94 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130761159
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H10904
Inparanoid 1 1.050 236 1.000 Inparanoid score I2110
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D264054at33208
OrthoFinder 1 1.000 FOG0003470
OrthoInspector 1 1.000 T476077
orthoMCL 1 0.900 OOG5_132890
Panther 1 1.100 LDO PTHR12277
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2935
TreeFam 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.