DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG1309 and Abhd12b

Sequence 1:NP_647880.1 Gene:CG1309 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001181962.1 Gene:Abhd12b MGIID:2685650 Length:359 Species:Mus musculus

Alignment Length:248 Identity:51/249 (20%)
Similarity:85/249 (34%) Gaps:54/249 (22%)


  Fly   217 YKVKTIDSNEIDTLFIDNRPNN---VGNGKTLVICSEGNAGFYEVGIMATPVALKYSVLGWNHPG 278
            |:....|.|.| .:::.....|   .|..|...:.|:|  ||:              ||..::.|
Mouse   128 YEASLSDGNPI-IIYLHGSGINRAFCGRIKLTQVLSDG--GFH--------------VLSVDYRG 175

  Fly   279 FAGSTGTPHPHQDKNAIDAVVQFAINNLRFPVEDIILYGWSIGGFSTLYAASVYPDVKG-----V 338
            |..||||  ..::....|.:..:.....|.....:.|:|.|:|......||.|. :.||     :
Mouse   176 FGDSTGT--TTEEGLTTDIICVYEWTKARSGRTPVCLWGHSLGTGVATNAARVL-EAKGCPVDAI 237

  Fly   339 VLDATFDDVLYLAVP--------RMPAALAGIVKVAIRNYCNLNNAELANEFNGPISFIRRTEDE 395
            :|:|.|.::....:.        ::|..|...|...........|.|.....:.|:..:...:|.
Mouse   238 ILEAPFTNIWAATINFPLVKMYWKLPGCLRTFVDALKEEKIVFPNDENVKFLSSPLLILHGEDDR 302

  Fly   396 I-----------IAEDNHIDTNRGNFLVLSVLKHRYPNIFGASQLNKAKGLLS 437
            .           ||...:.:..|...:|       :|..|....|.|:..|||
Mouse   303 TVPLEFGKQLYEIARSAYRNKERVKMVV-------FPPGFHHDYLFKSPMLLS 348

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 26/124 (21%)
Abhd12bNP_001181962.1 Hydrolase_4 138..336 CDD:288960 43/225 (19%)
Abhydrolase_5 139..336 CDD:289465 42/223 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93583539
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.