DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1309 and Abhd12b

DIOPT Version :9

Sequence 1:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001181962.1 Gene:Abhd12b / 100504285 MGIID:2685650 Length:359 Species:Mus musculus


Alignment Length:248 Identity:51/248 - (20%)
Similarity:85/248 - (34%) Gaps:54/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 YKVKTIDSNEIDTLFIDNRPNN---VGNGKTLVICSEGNAGFYEVGIMATPVALKYSVLGWNHPG 278
            |:....|.|.| .:::.....|   .|..|...:.|:|  ||:              ||..::.|
Mouse   128 YEASLSDGNPI-IIYLHGSGINRAFCGRIKLTQVLSDG--GFH--------------VLSVDYRG 175

  Fly   279 FAGSTGTPHPHQDKNAIDAVVQFAINNLRFPVEDIILYGWSIGGFSTLYAASVYPDVKG-----V 338
            |..||||  ..::....|.:..:.....|.....:.|:|.|:|......||.|. :.||     :
Mouse   176 FGDSTGT--TTEEGLTTDIICVYEWTKARSGRTPVCLWGHSLGTGVATNAARVL-EAKGCPVDAI 237

  Fly   339 VLDATFDDVLYLAVP--------RMPAALAGIVKVAIRNYCNLNNAELANEFNGPISFIRRTEDE 395
            :|:|.|.::....:.        ::|..|...|...........|.|.....:.|:..:...:|.
Mouse   238 ILEAPFTNIWAATINFPLVKMYWKLPGCLRTFVDALKEEKIVFPNDENVKFLSSPLLILHGEDDR 302

  Fly   396 I-----------IAEDNHIDTNRGNFLVLSVLKHRYPNIFGASQLNKAKGLLS 437
            .           ||...:.:..|...:|       :|..|....|.|:..|||
Mouse   303 TVPLEFGKQLYEIARSAYRNKERVKMVV-------FPPGFHHDYLFKSPMLLS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 26/123 (21%)
Abhd12bNP_001181962.1 FrsA <132..357 CDD:223999 50/244 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848914
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.