DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15011 and Nfx1

DIOPT Version :8

Sequence 1:NP_647879.1 Gene:CG15011 / 38518 FlyBaseID:FBgn0035518 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_076228.2 Gene:Nfx1 / 74164 MGIID:1921414 Length:1114 Species:Mus musculus

Alignment Length:835 Identity:253/836 (30%)
Similarity:343/836 (41%) Gaps:208/836 (25%)


  Fly    34 ENHILELLYKNYKPSDNAGSSKEAARTSTFLENTLHSGAATCLICIGSIRRVEAIWSCESCYCFF 98
            :||:|    ||.:  .:.||..|...|..:          .|::|...::....:|||:||:..|
Mouse   327 QNHML----KNVE--THTGSLIEQLTTEKY----------ECMVCCELVQVTAPVWSCQSCFHVF 375

  Fly    99 HLKCIQRWANDSMMQMKVKAAEQQNGQGHYNHLGEFVPPKRQKSLHWCCPKCRRDYQPADKPTQY 163
            ||.||::||     :.....|:.|:|                    |.||.|:.  ..|..|..|
Mouse   376 HLNCIKKWA-----RSPASHADGQSG--------------------WRCPACQN--VSAHVPNTY 413

  Fly   164 NCFCGKEVNPENQPFLVPHSCGEHCGKLLQP--KCGHDCKLLCHPGPCPPCAQQAQVSCLCGKSS 226
            .|||||..|||.....:||||||.|.| .||  .|.|.|.|||||||||||......:|.||::.
Mouse   414 TCFCGKVKNPEWSRNEIPHSCGEVCRK-KQPGQDCPHSCNLLCHPGPCPPCPAFTTKTCECGRTR 477

  Fly   227 PRSVRCIDK-QWTCQQTCKELLACGKHKCNQVCHQPGKCPPCTSKSLQPCECQRESKMVNC---- 286
             .:|||... ...|...|:.:|.||:|.|.::|| .|:|.||.....|.|.|...|:.|.|    
Mouse   478 -HTVRCGQPVSVHCSNACENILNCGQHHCAELCH-GGQCQPCRIILNQVCYCGSTSRDVLCGTDV 540

  Fly   287 --SD--RKWKCQNVCGAPFACGLHICEKVCHAGPCGDGECPL---QVRSCPCGKN--TQV----- 337
              ||  ..:.|..:||....||.|.|.:|||..||  ..||.   .||.||||:.  :|:     
Mouse   541 GKSDGFGDFSCLKICGKDLKCGSHTCSQVCHPQPC--QPCPRLPHLVRYCPCGQTPLSQLLEHGS 603

  Fly   338 ---RPCNETEETCGDTCQKLLSCGQ----HTCTQRCHRGPCISCPIRTKKKCRCGLHEKELPCSK 395
               :.|.:...:||..|.|.|:||.    |||.:.||.|.|..|...:...|||....|||||:.
Mouse   604 NARKTCMDPVPSCGKVCGKPLACGSSDFIHTCEKLCHEGDCGPCSRTSVISCRCSFRTKELPCTS 668

  Fly   396 ------EFACETKCKQMRDCGKHACNRKCCGDQCPPCEKICGKQLSCNKHKCQSVCHNGPCYPCK 454
                  .|.|:.:|.:.|.||:|.||..||.|:...|..|||::|.|..|:|:..||.|.|..|.
Mouse   669 LKSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLRCGLHRCEEPCHRGNCQTCW 733

  Fly   455 LES--QINCRCGKT--KKSVPCGRERSARIVCLELCRITPKCHHAIKHRCHKGD-CPPCGQVCGL 514
            ..|  ::.|.||.:  ...||||.....   |.:.|....:|.|.:.|.||..: ||||..:   
Mouse   734 QASFDELTCHCGASVIYPPVPCGTRPPE---CTQTCARIHECDHPVYHSCHSEEKCPPCTFL--- 792

  Fly   515 PNDTSKCGHICKARCHEAVRVNKPKEARPQAKKYEYKALPHPRCEEGVIVTCIGGHEV-ATWPCW 578
               |.|                                            .|:|.||: :..|| 
Mouse   793 ---TQK--------------------------------------------WCMGKHELRSNIPC- 809

  Fly   579 NSKPTSCQRSCARQLKCGNHKCSLVCHFVPLPQDMSAQTGCANCEEGCTVPRPTGCIHACPKGCH 643
            :....||...|:..|.||.|||..:||......|.:       |::.||.|| ..|.|.|...||
Mouse   810 HLVDISCGLPCSAMLPCGMHKCQRLCHKGECLVDEA-------CKQPCTTPR-GDCGHPCMAPCH 866

  Fly   644 PP-PC--APCNFVIKTKCHCGLNQLVYKCNEYYDETGSVQEIIERREKLRSCGNRCLKNYPCGHR 705
            |. ||  ..|...::.:|.||..:.:..|:|   .:|:.|.|:                      
Mouse   867 PSLPCPVTACKAKVELQCECGRRKEMVICSE---ASGTYQRIV---------------------- 906

  Fly   706 CTAICHTGKCPNPELCRKKVRIFCACKRL--KQEIACDKHRAGQTFLDCDSNCKAEQIRVQAAEQ 768
              ||....|..:.:| ...|.|    .:|  |:|:.       |..|.||..|.|.:.|.:.||.
Mouse   907 --AISMASKITDMQL-GDSVEI----SKLITKKEVQ-------QARLQCDEECAALERRKRLAEA 957

  Fly   769 LQLEQKRRDEEERN-RLELEKF----------EAKFGKRKHKERKTVGSGPAKTK 812
            ..:..   |.:..| |....||          :.||.....||.:|:.....|.|
Mouse   958 FDITD---DSDPFNVRSSASKFSDSLKDDARKDLKFVSDVEKEMETLVEAVNKGK 1009

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15011NP_647879.1 NF-X1-zinc-finger 184..228 CDD:100116 24/46 (52%)
NF-X1-zinc-finger 239..288 CDD:100116 20/55 (36%)
NF-X1-zinc-finger 293..342 CDD:100116 22/62 (35%)
NF-X1-zinc-finger 347..395 CDD:100116 23/52 (44%)
NF-X1-zinc-finger 426..474 CDD:100116 21/52 (40%)
NF-X1-zinc-finger 692..740 CDD:100116 9/50 (18%)
Nfx1NP_076228.2 Interaction with PABPC1 and PABC4. {ECO:0000250} 9..26
NF-X1-zinc-finger 490..538 CDD:100116 19/49 (39%)
NF-X1-zinc-finger 551..593 CDD:100116 20/44 (45%)
NF-X1-zinc-finger 616..668 CDD:100116 23/52 (44%)
NF-X1-zinc-finger 678..726 CDD:100116 21/48 (44%)
NF-X1-zinc-finger 705..757 CDD:100116 21/52 (40%)
NF-X1-zinc-finger 816..861 CDD:100116 18/53 (34%)
R3H_NF-X1 981..1054 CDD:100072 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1952
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.