DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15011 and stc

Sequence 1:NP_647879.1 Gene:CG15011 FlyBaseID:FBgn0035518 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_476599.1 Gene:stc FlyBaseID:FBgn0001978 Length:1106 Species:Drosophila melanogaster

Alignment Length:859 Identity:257/860 (30%)
Similarity:354/860 (41%) Gaps:221/860 (26%)


  Fly     5 NKAQAKNLAAAQKLVDTYASSSEDEGELDENHILELLYKNYKPSDNAGSSKEAARTSTFLENTLH 69
            |:.:......|...:||...|:....| .::.:.::..:...|...|.:.|.:.|..  |...:.
  Fly   319 NRDRINGFPRAVDDLDTSNESAHPSPE-KQSQLQQISPRRGPPLPPADNEKLSQREK--LVRDIE 380

  Fly    70 SGAATCLICIGSIRRVEAIWSCESCYCFFHLKCIQRWANDSMMQMKVKAAEQQNGQGHYNHLGEF 134
            .....||:|:.:|:..:..|||.:||...||||...||:.|                        
  Fly   381 QRRLECLVCVEAIKSHQPTWSCRNCYHMLHLKCTITWASSS------------------------ 421

  Fly   135 VPPKRQKSLHWCCPKCRRDYQPADKPTQYNCFCGKEVNPENQPFLVPHSCGEHCGKLLQPKCGHD 199
                 :..:.|.||.|:...|  |.|..|.|||||..||......:.|||||.|.::  ..|.|.
  Fly   422 -----KSEVGWRCPACQNVLQ--DLPRDYLCFCGKLKNPPVSRTELAHSCGEVCCRI--EGCSHA 477

  Fly   200 CKLLCHPGPCPPCAQQAQVSCLCGKSSPRSVRCIDKQWT-CQQTCKELLACGKHKCNQVCHQPGK 263
            |.|||||||||||......||.||:|: ::::|..|:.. |.:.|.:||.||:|:|...||. ||
  Fly   478 CTLLCHPGPCPPCQANVVRSCGCGRST-KTMQCAMKEEVLCGEICDKLLNCGEHRCQAECHS-GK 540

  Fly   264 CPPCTSKSLQPCECQRESKMVNCS-----DRKWKCQNVCGAPFACGLHICEKVCHAGPCGDGEC- 322
            |..|:.:.:|.|.|.::.:.|.|:     .|.:.|::.||.|..||.|.|:..||||.|  ..| 
  Fly   541 CAACSEQVVQQCHCGKQERKVPCTRESQDKRTYSCKDSCGQPLPCGHHKCKDSCHAGSC--RPCK 603

  Fly   323 --PLQVRSCPCGKNT----QVRPCNETEETCGDTCQKLLSCGQ----HTCTQRCHRGPCISCPIR 377
              |.|:.||||||..    |...|.:...||...|.:.|.||:    |.|..:||.|.|..||.:
  Fly   604 LSPEQITSCPCGKMPVPAGQRSSCLDPIPTCEGICSRTLRCGKPAHPHQCGSKCHLGQCPPCPKQ 668

  Fly   378 TKKKCRCGLHEKELPC------SKEFACETKCKQMRDCGKHACNRKCCGDQCPPCEKICGKQLSC 436
            |..|||||..::.:.|      :.:..|:.:|.:.|.||||.||.:||.|....|...|.:.|||
  Fly   669 TGVKCRCGHMDQMIKCRQLCNRADDARCKRRCTKKRSCGKHKCNVECCIDIDHDCPLPCNRTLSC 733

  Fly   437 NKHKCQSVCHNGPCYPCKLES--QINCRCGK--TKKSVPCGRERSARIVC-LELCRITPKCHHAI 496
            .||||...||.|.|.||...|  ::.|.||.  ....||||.::.   :| |...||.| |.|..
  Fly   734 GKHKCDQPCHRGNCPPCYRSSFEELYCECGAEVIYPPVPCGTKKP---ICKLPCSRIHP-CDHPP 794

  Fly   497 KHRCHKG-DCPPCGQVCGLPNDTSKCGHICKARCHEAVRVNKPKEARPQAKKYEYKALPHPRCEE 560
            :|.||.| .||||                                                    
  Fly   795 QHNCHSGPTCPPC---------------------------------------------------- 807

  Fly   561 GVIVT---CIGGHEV-ATWPCWNSKPT-SCQRSCARQLKCGNHKCSLVCHFVPLPQDMSAQTGCA 620
             :|.|   |.|.||: .|.||  |:|. ||..:|.:.|.||.|||...||..|      .|:...
  Fly   808 -MIFTTKLCHGNHELRKTIPC--SQPNFSCGMACGKPLPCGGHKCIKPCHEGP------CQSAGE 863

  Fly   621 NCEEGCTVPRPTGCIHACPKGCHPPPC--APCNFVIKTKCHCGLNQLVYKCNEYYDETGSVQEII 683
            .|.:.||.|||| |.|.|...||...|  .||..:::.:|.||                      
  Fly   864 ICRQSCTKPRPT-CGHKCAAACHEGACPETPCKELVEVQCECG---------------------- 905

  Fly   684 ERREKLRSCGNRCLKNYPCGHRCTAICHTGKCPNPELCRKKVRIFCACKRLK------------- 735
             .|::.|||                         .||.|:..||  |..:|.             
  Fly   906 -NRKQNRSC-------------------------QELAREHSRI--ATIQLASSMAEMSRGNYME 942

  Fly   736 -QEIACDKHRAGQTFLDCDSNCK-AEQIRVQAAEQLQLEQKRRDEEERNRLELEKFEAKFGKRKH 798
             .||.....::.:| |||:..|: .|:.|..||   .|.....|.:::...:..:|...|.|:  
  Fly   943 LSEILAPAKKSNKT-LDCNDECRLLERNRRLAA---ALSSGNSDTKQKCLTKYSEFVRGFAKK-- 1001

  Fly   799 KERKTVGSGPAKTK 812
                    .||.||
  Fly  1002 --------NPALTK 1007

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15011NP_647879.1 NF-X1-zinc-finger 184..228 CDD:100116 23/44 (52%)
NF-X1-zinc-finger 239..288 CDD:100116 19/54 (35%)
NF-X1-zinc-finger 293..342 CDD:100116 24/56 (43%)
NF-X1-zinc-finger 347..395 CDD:100116 20/58 (34%)
NF-X1-zinc-finger 426..474 CDD:100116 23/52 (44%)
NF-X1-zinc-finger 692..740 CDD:100116 10/62 (16%)
stcNP_476599.1 NF-X1-zinc-finger 464..510 CDD:100116 24/49 (49%)
NF-X1-zinc-finger 517..565 CDD:100116 19/49 (39%)
NF-X1-zinc-finger 575..617 CDD:100116 22/44 (50%)
NF-X1-zinc-finger 634..686 CDD:100116 20/52 (38%)
NF-X1-zinc-finger 723..775 CDD:100116 23/52 (44%)
NF-X1-zinc-finger 834..882 CDD:100116 22/55 (40%)
NF-X1-zinc-finger 865..915 CDD:100116 22/99 (22%)
R3H_NF-X1 996..1069 CDD:100072 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113164356
eggNOG 1 0.900 E1_KOG1952
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12360
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.