DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15011 and Nfx1

DIOPT Version :8

Sequence 1:NP_647879.1 Gene:CG15011 / 38518 FlyBaseID:FBgn0035518 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_001019955.2 Gene:Nfx1 / 313166 RGDID:1310277 Length:1114 Species:Rattus norvegicus

Alignment Length:842 Identity:253/843 (30%)
Similarity:344/843 (41%) Gaps:201/843 (24%)


  Fly     8 QAKNLAAAQKLVDTYASSSEDEGELDENHILELLYKNYKPSDNAGSSKEAARTSTFLENTLHSGA 72
            |.||....|   |....|....|:  :||:|    ||.:  .:.||..|...|..:         
  Rat   306 QEKNAGRRQ---DPQVLSPFPRGK--QNHML----KNVE--THTGSLIEQLTTEKY--------- 350

  Fly    73 ATCLICIGSIRRVEAIWSCESCYCFFHLKCIQRWANDSMMQMKVKAAEQQNGQGHYNHLGEFVPP 137
             .|::|...::....:|||:||:..|||.||::||     :.....|:.|:|             
  Rat   351 -ECMVCCELVQVTAPVWSCQSCFHVFHLNCIKKWA-----RSPASHADGQSG------------- 396

  Fly   138 KRQKSLHWCCPKCRRDYQPADKPTQYNCFCGKEVNPENQPFLVPHSCGEHCGKLLQP--KCGHDC 200
                   |.||.|:.  ..|..|:.|.|||||..|||.....:||||||.|.| .||  .|.|.|
  Rat   397 -------WRCPACQN--VSAHVPSTYTCFCGKVKNPEWSRNEIPHSCGEVCRK-KQPGQDCPHSC 451

  Fly   201 KLLCHPGPCPPCAQQAQVSCLCGKSSPRSVRCIDK-QWTCQQTCKELLACGKHKCNQVCHQPGKC 264
            .|||||||||||......:|.||::. .:|||... ...|...|:.:|.||:|:|.::|| .|:|
  Rat   452 NLLCHPGPCPPCPAFTTKTCECGRTR-HTVRCGQPVSVHCSNVCENILNCGQHRCAELCH-AGQC 514

  Fly   265 PPCTSKSLQPCECQRESKMVNC------SD--RKWKCQNVCGAPFACGLHICEKVCHAGPCGDGE 321
            .||.....|.|.|...|:.|.|      ||  ..:.|..:||....||.|.|.:|||..||  ..
  Rat   515 QPCRIILNQVCYCGSTSRDVLCGTDVGKSDGFGDFSCLKICGKDLKCGSHTCSQVCHPQPC--QP 577

  Fly   322 CPL---QVRSCPCGKN--TQV--------RPCNETEETCGDTCQKLLSCGQ----HTCTQRCHRG 369
            ||.   .||.||||:.  :|:        :.|.:...:||..|.|.||||.    |||.:.||.|
  Rat   578 CPRLPHLVRYCPCGQTPLSQLLEHGSNGRKTCMDPVPSCGKVCGKPLSCGSSDFIHTCEKLCHEG 642

  Fly   370 PCISCPIRTKKKCRCGLHEKELPCSK------EFACETKCKQMRDCGKHACNRKCCGDQCPPCEK 428
            .|..|...:...|||....|||||:.      .|.|:.:|.:.|.||:|.||..||.|:...|..
  Rat   643 DCGPCSRTSVISCRCSFRTKELPCTSLKSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPL 707

  Fly   429 ICGKQLSCNKHKCQSVCHNGPCYPCKLES--QINCRCGKT--KKSVPCGRERSARIVCLELCRIT 489
            |||::|.|..|:|:..||.|.|..|...|  ::.|.||.:  ...||||.....   |.:.|...
  Rat   708 ICGRKLRCGLHRCEEPCHRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPE---CTQTCARI 769

  Fly   490 PKCHHAIKHRCHKGD-CPPCGQVCGLPNDTSKCGHICKARCHEAVRVNKPKEARPQAKKYEYKAL 553
            .:|.|.:.|.||..: ||||..:      |.|                                 
  Rat   770 HECDHPVYHSCHSEEKCPPCTFL------TQK--------------------------------- 795

  Fly   554 PHPRCEEGVIVTCIGGHEV-ATWPCWNSKPTSCQRSCARQLKCGNHKCSLVCHFVPLPQDMSAQT 617
                       .|:|.||: :..|| :....||...|:..|.||.|||..:||......|.:   
  Rat   796 -----------WCMGKHELRSNIPC-HLVDISCGLPCSAMLPCGMHKCQRLCHKGECLVDEA--- 845

  Fly   618 GCANCEEGCTVPRPTGCIHACPKGCHPP-PC--APCNFVIKTKCHCGLNQLVYKCNEYYDETGSV 679
                |::.||.|| ..|.|.|...|||. ||  ..|...::.:|.||..:.:..|:|   .:|:.
  Rat   846 ----CKQPCTTPR-ADCGHPCMAPCHPSLPCPVTACKAKVELQCECGRRKEMVICSE---ASGTY 902

  Fly   680 QEIIERREKLRSCGNRCLKNYPCGHRCTAICHTGKCPNPELCRK-KVRIFCACKRLKQEIACDKH 743
            |                        |..||....|..:.:|... ::..|...|.::        
  Rat   903 Q------------------------RIAAISMASKITDMQLGDSVEISKFITKKEVQ-------- 935

  Fly   744 RAGQTFLDCDSNCKAEQIRVQAAEQLQLEQKRRDEEERN-RLELEKFEAKFGKRKHKERKTV 804
               |..|.||..|.|.:.:.:.||...:..   |.:..| |....||.........|:.|.|
  Rat   936 ---QARLQCDEECAALERKKRLAEAFDITD---DSDPFNVRSSASKFSDSLKDDARKDFKFV 991

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15011NP_647879.1 NF-X1-zinc-finger 184..228 CDD:100116 24/46 (52%)
NF-X1-zinc-finger 239..288 CDD:100116 20/55 (36%)
NF-X1-zinc-finger 293..342 CDD:100116 22/62 (35%)
NF-X1-zinc-finger 347..395 CDD:100116 24/52 (46%)
NF-X1-zinc-finger 426..474 CDD:100116 21/52 (40%)
NF-X1-zinc-finger 692..740 CDD:100116 7/49 (14%)
Nfx1NP_001019955.2 NF-X1-zinc-finger 490..538 CDD:100116 19/49 (39%)
NF-X1-zinc-finger 551..593 CDD:100116 20/44 (45%)
NF-X1-zinc-finger 616..668 CDD:100116 24/52 (46%)
NF-X1-zinc-finger 678..726 CDD:100116 21/48 (44%)
NF-X1-zinc-finger 705..757 CDD:100116 21/52 (40%)
NF-X1-zinc-finger 816..861 CDD:100116 18/53 (34%)
R3H_NF-X1 981..1054 CDD:100072 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1952
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D299100at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.