DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15011 and nfx-1

DIOPT Version :8

Sequence 1:NP_647879.1 Gene:CG15011 / 38518 FlyBaseID:FBgn0035518 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_498394.1 Gene:nfx-1 / 175902 WormBaseID:WBGene00007048 Length:1119 Species:Caenorhabditis elegans

Alignment Length:872 Identity:245/873 (28%)
Similarity:347/873 (40%) Gaps:246/873 (28%)


  Fly     8 QAKNLAAAQKLVDTY---ASSSEDEGELDENHILELLYKNYK-PSDNAGSSK--EAAR------- 59
            |.:.|...::..|::   .|...:..:|:.:.|.....|:.: ||.|.|:|:  :.||       
 Worm   141 QRRQLEIQEQRGDSHPQNQSRQNNRNQLNVDRIANQQNKSVQNPSRNPGNSRRGQGARRREQKEE 205

  Fly    60 ------TSTFLENTLHSGAA--------TCLICIGSIRRVEAIWSCESCYCFFHLK--CIQRWAN 108
                  |....:..|..|..        .|.||...|...:.:|||::||..||:.  ||..||.
 Worm   206 PLTEEETKILADKPLREGLVYLLENNKYECAICYTRITTRQGVWSCKTCYHIFHISTGCITDWAR 270

  Fly   109 DSMMQMKVKAAEQQNGQGHYNHLGEFVPPKRQKSLHWCCPKCRRDYQPADKPTQYNCFCGKEVNP 173
            .|.                          .::.:..|.||.|:.:.:  ..|..|.||||:..||
 Worm   271 SSR--------------------------DKEGANTWRCPTCQTENE--TMPYNYYCFCGRMRNP 307

  Fly   174 ENQPFLVPHSCGEHCGKLLQPKCGHDCKLLCHPGPCPPCAQQAQVSCLCGKSSPRSVRC-IDKQW 237
            ..:...|||||||.||...:..|.|.|..|||||||..|......||.|||:. :|||| .|::.
 Worm   308 NFRVGEVPHSCGETCGGARKFGCPHPCTELCHPGPCIECKLFTTKSCNCGKTK-KSVRCGSDQEV 371

  Fly   238 TCQQTCKELLACGKHKCNQVCHQPGKCPPCTSKSLQPCECQRESKMVN---CSDRKWKCQNVCGA 299
            .|:..|.:.|:||:|.|.::||. |.|..||....|.|.|.:..|.|:   |:..|:.|.:.|..
 Worm   372 MCETVCGKQLSCGQHNCERICHS-GDCGECTVILEQDCFCGKTPKEVSCNPCAHEKYSCGSECDG 435

  Fly   300 PFACGLHICEKVCHAGPCGDGECPL---QVRSCPCGKNT------QVRPCNETEETCGDTCQKLL 355
            .|:||:|.|.|.||...|  |||..   ::|:||||:||      ..:.|.:...||...|.|.|
 Worm   436 MFSCGIHHCTKKCHDKEC--GECETGANRIRTCPCGRNTLQSLGVTRKKCTDMVPTCDSVCDKWL 498

  Fly   356 SCG----QHTCTQRCHRGPCISCPIRTKKKCRCGLHEKELPCSK---------EFACETKCKQMR 407
            :||    .|.|.::||.|||..|.:.|...||||..:..:||.:         |:.|..:|::.:
 Worm   499 TCGTPGKNHHCREKCHEGPCPPCNLNTSVICRCGTSKGVIPCDEYLQIMKTTGEYLCTKRCRKKK 563

  Fly   408 DCGKHACNRKCCGDQCPPCEKICGKQLSCNKHKCQSVCHNGPCYPCKLESQIN---CRCGKTKK- 468
            .||.|.|...||......|.::|.|:|||..|.|::|||.|.|.|| |::..:   |.||.|.: 
 Worm   564 SCGMHKCQEVCCIQDEHFCLQMCNKRLSCGIHTCENVCHAGQCRPC-LQASFDEQFCHCGHTVRM 627

  Fly   469 -SVPCGRERSARI-VCLELCRITPKCHHAIKHRCH-KGDCPPCGQVCGLPNDTSKCGHICKARCH 530
             .:|||    ||: ||.:.|.....|.|::.|:|| :.:||||.|:      |.|          
 Worm   628 PPIPCG----ARLPVCSQPCVRPHSCDHSVSHKCHGEQNCPPCTQL------TEK---------- 672

  Fly   531 EAVRVNKPKEARPQAKKYEYKALPHPRCEEGVIVTCIGGHEV-ATWPCWNSKPTSCQRSCARQLK 594
                                              .|.|||.| ...|| :....||...|.:.||
 Worm   673 ----------------------------------MCYGGHRVRKNIPC-HIDSVSCGVVCKKPLK 702

  Fly   595 CGNHKCSLVCHFVPLPQDMSAQTGCANCE-EGCTVPRPTGCIHACPKGCHPPPCAPCNFVIKTKC 658
            ||.|.|...||             ...|| ||          ..|.|.|.               
 Worm   703 CGVHVCQRTCH-------------GEECEKEG----------EKCTKKCE--------------- 729

  Fly   659 HCGLNQLVYKCNEYYDETGSVQEIIERREKLRSCGNRCLKNYPCGHRCTAICHTGKCPNPELCRK 723
                               :::|:                   |.|.|...||......|..|:.
 Worm   730 -------------------TIREL-------------------CEHPCALPCHEDSPCEPSPCKA 756

  Fly   724 KVRIFCACKRLKQEIAC-----------DKHRAGQTFLDCDSNCKAEQIRVQAAEQLQLEQKRRD 777
            .|||.|.|.|:|::..|           :|....::..|.:.....|.|..::....||...:.|
 Worm   757 SVRISCECGRIKKDAPCCEVDKMILSKLEKEEEEKSESDGEEKVVKEGILKRSTSFSQLNCMKCD 821

  Fly   778 EE----ERNRLELEKFEA---KFGKRK 797
            :|    ||||...|..|.   ::|..|
 Worm   822 DECKKLERNRKVAEALEVDTDEYGMNK 848

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15011NP_647879.1 NF-X1-zinc-finger 184..228 CDD:100116 21/44 (48%)
NF-X1-zinc-finger 239..288 CDD:100116 19/52 (37%)
NF-X1-zinc-finger 293..342 CDD:100116 22/58 (38%)
NF-X1-zinc-finger 347..395 CDD:100116 21/52 (40%)
NF-X1-zinc-finger 426..474 CDD:100116 23/53 (43%)
NF-X1-zinc-finger 692..740 CDD:100116 14/48 (29%)
nfx-1NP_498394.1 NF-X1-zinc-finger 318..367 CDD:100116 25/50 (50%)
NF-X1-zinc-finger 373..419 CDD:100116 18/47 (38%)
NF-X1-zinc-finger 429..472 CDD:100116 20/45 (44%)
NF-X1-zinc-finger 490..542 CDD:100116 21/52 (40%)
NF-X1-zinc-finger 582..634 CDD:100116 23/57 (40%)
NF-X1-zinc-finger 693..740 CDD:100116 21/123 (17%)
R3H 860..935 CDD:294210
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1952
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D299100at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.