DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15011 and Nfxl1

DIOPT Version :8

Sequence 1:NP_647879.1 Gene:CG15011 / 38518 FlyBaseID:FBgn0035518 Length:840 Species:Drosophila melanogaster
Sequence 2:NP_598682.2 Gene:Nfxl1 / 100978 MGIID:1923646 Length:918 Species:Mus musculus

Alignment Length:862 Identity:366/863 (42%)
Similarity:481/863 (56%) Gaps:70/863 (8%)


  Fly     2 EKFNKAQAKNLAAAQKLVDTY-ASSSEDEGELD----ENHILELLYKNYKPSDNAGSSKEAARTS 61
            :||.:.:..|.|||:||::.: :||||:||:.|    :..|:...:..| .:...|...|..||.
Mouse    90 KKFEEIKKSNQAAARKLLEEHCSSSSEEEGDEDLEGKQGKIVANTFTTY-TTHTDGDIHELERTK 153

  Fly    62 TFLENTLHSGAATCLICIGSIRRVEAIWSCESCYCFFHLKCIQRWANDSMMQMKVKAAEQQNGQG 126
            .:|.....:||.||||||.|::|.:|:|||..|:|.||:.|||:||.||  |..|.:....:   
Mouse   154 QYLNEAFQAGAMTCLICIASVKRNQAVWSCSGCFCIFHMPCIQKWAKDS--QFLVSSVTDDD--- 213

  Fly   127 HYNHLGEFVPPKRQKSLHWCCPKCRRDYQPADKPTQYNCFCGKEVNPENQPFLVPHSCGEHCGKL 191
                .|       :|...|.|||||.:|:.::.|::|.|:|||..:|...|:|||||||:.|.:.
Mouse   214 ----FG-------KKDYPWPCPKCRFEYKRSETPSRYYCYCGKVEDPPLDPWLVPHSCGQVCERE 267

  Fly   192 LQPKCGHDCKLLCHPGPCPPCAQQAQVSCLCGKSSPRSVRCIDKQWTCQQTCKELLACGKHKCNQ 256
            .:|.|||.|.|||||||||||.:....:|.|.|:.|...||..|||:||..|...|.||.|||..
Mouse   268 FKPSCGHKCLLLCHPGPCPPCPKMVTTTCYCKKAKPIPRRCSAKQWSCQLPCGRKLLCGHHKCEN 332

  Fly   257 VCHQPGKCPPCTSKSLQPCECQRESKMVNCSDRKWKCQNVCGAPFACGLHICEKVCHAGPCGDGE 321
            .|| .|.|.||...|.|.|.|.::....:|:...|.|..|||....||.|.||:|||.|.|  ||
Mouse   333 PCH-AGNCQPCPRVSRQKCVCGKKVAERSCASPVWHCDQVCGKTLPCGNHTCEQVCHVGAC--GE 394

  Fly   322 CPLQ-VRSCPCGKNTQVRPCNETEETCGDTCQKLLSCGQHTCTQRCHRGPCISCPIRTKKKCRCG 385
            ||.. .|||||.|:....||.|...||||:|.|:|.||.|.|:||||||||.:|....:|:||||
Mouse   395 CPRSGKRSCPCQKSKFSLPCTEDVPTCGDSCDKILECGIHRCSQRCHRGPCETCRQEVEKQCRCG 459

  Fly   386 LHEKELPCSKEFACETKCKQMRDCGKHACNRKCCGDQCPPCEKICGKQLSCNKHKCQSVCHNGPC 450
            .|.|.:||.|.:.|||||.:||||.||.|.||||...||||::.||:.|.|..|||.||||.|.|
Mouse   460 KHTKRMPCHKPYLCETKCVKMRDCQKHQCRRKCCPGNCPPCDQNCGRTLGCRNHKCPSVCHRGSC 524

  Fly   451 YPCKLESQINCRCGKTKKSVPCGRERSAR-IVCLELCRITPKCHHAI--KHRCHKGDCPPCGQVC 512
            |||.....:.|.||..|.:|||||||:.| ..|.|||...|.||||.  |||||.|.||||.|.|
Mouse   525 YPCPETVDVKCNCGNAKVTVPCGRERTTRPPKCKELCSRPPTCHHASQEKHRCHFGPCPPCHQPC 589

  Fly   513 GLPNDTSKCGHICKARCHEAVRVNK--------PKEARPQAKKYEYKALPHPRCEEGVIVTCIGG 569
              .....||||:|...||:...|.:        |.| :|....:...|||.|.|:..:.|.|:|.
Mouse   590 --QKVLEKCGHLCPESCHDQALVKQTGRHQPSGPWE-QPAEPAFIQTALPCPPCQVPIPVECLGK 651

  Fly   570 HEVATWPCWNSKPTSCQRSCARQLKCGNHKCSLVCHFVPLPQDMSAQTG-------CANCEEGCT 627
            |||:..||....|.||:|.|.|.|:|.||.|...||.|   .::.:.||       |.:|||||:
Mouse   652 HEVSPLPCHAVGPYSCKRLCGRMLRCQNHTCMKECHKV---TEVDSSTGKNKAGPECFHCEEGCS 713

  Fly   628 VPRPTGCIHACPKGCHPPPCAPCNFVIKTKCHCGLNQLVYKCNEYYDETGSVQEIIERREKLRSC 692
            ..||.||.|.|...|||..|.||..:::.||||.:..|..:|.:.  .|..|.|    :..|..|
Mouse   714 KSRPAGCPHPCVLPCHPGKCPPCVQMLRIKCHCKITSLYVECRKI--TTADVSE----KNLLSCC 772

  Fly   693 GNRCLKNYPCGHRCTAICHTGKCP-NPELCRKKVRIFCACKRLKQEIACDKHRAGQTFLDCDSNC 756
            .|:|.|..||||||..:||.|:|| |   |.:||::.|.|||:|:|:.|:|.|..|..::||:.|
Mouse   773 KNQCPKELPCGHRCKEMCHPGECPFN---CNQKVKLRCPCKRIKRELPCNKVRENQVSVECDATC 834

  Fly   757 KAEQIRVQAAEQLQLEQKRRDEEERNRLELEKFEAKFGKRKHKERK----TVGSGPAKTKIDWQR 817
            |..:.:....::.:......:|:.|.:.|||.||.:...|:.|.||    .|...|      ||:
Mouse   835 KEMKRKASEVKEAEANAALEEEKRRQQAELEAFENRLKGRRKKSRKRDEVAVELSP------WQK 893

  Fly   818 RAIYAVSILTVVGAIVV 834
            ...|.:.:..||.|:::
Mouse   894 YKSYLLPVCAVVVAVLM 910

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15011NP_647879.1 NF-X1-zinc-finger 184..228 CDD:100116 23/44 (52%)
NF-X1-zinc-finger 239..288 CDD:100116 20/49 (41%)
NF-X1-zinc-finger 293..342 CDD:100116 26/50 (52%)
NF-X1-zinc-finger 347..395 CDD:100116 28/48 (58%)
NF-X1-zinc-finger 426..474 CDD:100116 25/48 (52%)
NF-X1-zinc-finger 692..740 CDD:100116 25/49 (51%)
Nfxl1NP_598682.2 NF-X1-zinc-finger 315..363 CDD:100116 20/49 (41%)
NF-X1-zinc-finger 368..416 CDD:100116 26/50 (52%)
NF-X1-zinc-finger 421..469 CDD:100116 28/48 (58%)
NF-X1-zinc-finger 500..548 CDD:100116 25/48 (52%)
NF-X1-zinc-finger 708..755 CDD:100116 22/47 (47%)
NF-X1-zinc-finger 772..818 CDD:100116 25/49 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C362237600
eggNOG 1 0.900 E1_KOG1952
Hieranoid 1 1.000
Homologene 1 1.000 H26752
Inparanoid 1 1.050 759 1.000 Inparanoid score I544
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D299100at2759
OrthoFinder 1 1.000 FOG0007112
OrthoInspector 1 1.000 T1085312
orthoMCL 1 0.900 OOG5_132673
Panther 1 1.100 LDO PTHR12360
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5752
TreeFam 1 0.960
1312.890

Return to query results.
Submit another query.