DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15011 and nfxl1

DIOPT Version :8

Sequence 1:NP_647879.1 Gene:CG15011 / 38518 FlyBaseID:FBgn0035518 Length:840 Species:Drosophila melanogaster
Sequence 2:XP_002666590.3 Gene:nfxl1 / 100333008 ZFINID:ZDB-GENE-110411-178 Length:885 Species:Danio rerio

Alignment Length:861 Identity:370/862 (43%)
Similarity:465/862 (54%) Gaps:62/862 (7%)


  Fly     3 KFNKAQAKNLAAAQKL-VDTYASSSEDEGELD------ENHILELLYKNYKPSDNAGSSKEAART 60
            :|::.|..:.||||:| .|||:||||||.:.|      ...||:.....|.........:...:|
Zfish    45 RFDEIQKSDRAAAQRLTTDTYSSSSEDEDDDDSEDGGKRGKILKSALSPYASHTGDTDGRLLEQT 109

  Fly    61 STFLENTLHSGAATCLICIGSIRRVEAIWSCESCYCFFHLKCIQRWANDSMMQMKVKAAEQQNGQ 125
            ..:|.....||..||||||.|:||.:.:|||..|||.||:.|||:||.||:..:.....|....:
Zfish   110 RHYLHEVCQSGGVTCLICIASVRRTQPVWSCVGCYCIFHITCIQKWAKDSIFLVSSVTDEDFGKK 174

  Fly   126 GHYNHLGEFVPPKRQKSLHWCCPKCRRDYQPADKPTQYNCFCGKEVNPENQPFLVPHSCGEHCGK 190
            .|                .|.|||||.:|.|...||:|.|:||||..|...|:|:|||||:.||:
Zfish   175 DH----------------PWPCPKCRHEYSPHQTPTRYYCYCGKEAEPAPDPWLLPHSCGQVCGR 223

  Fly   191 LLQPKCGHDCKLLCHPGPCPPCAQQAQVSCLCGKSSPRSVRCIDKQWTCQQTCKELLACGKHKCN 255
            ..:|.|||.|.|||||||||||.|...|||||||||....||..|.|:|.:.|...|.|..|.|.
Zfish   224 EFKPSCGHRCLLLCHPGPCPPCPQMVSVSCLCGKSSRVPRRCSAKAWSCTKICGRKLPCRTHTCA 288

  Fly   256 QVCHQPGKCPPCTSKSLQPCECQRESKMVNCSDRKWKCQNVCGAPFACGLHICEKVCHAGPCGDG 320
            ..|| .|:|..|...|||.|.|.|:.....|:..:|.|..|||.|.:||.|.||:|||||.|  |
Zfish   289 NTCH-AGECAACPRVSLQACACGRQRAERPCASPEWHCDQVCGRPLSCGNHKCERVCHAGVC--G 350

  Fly   321 ECP-LQVRSCPCGKNTQVRPCNETEETCGDTCQKLLSCGQHTCTQRCHRGPCISCPIRTKKKCRC 384
            ||| ...|||.|||...|.||.....||||||.|.|.||.|||:.|||||.|.:|....:|.|||
Zfish   351 ECPRAGNRSCSCGKTKSVLPCTVDVPTCGDTCGKNLDCGLHTCSMRCHRGACETCRQEVEKTCRC 415

  Fly   385 GLHEKELPCSKEFACETKCKQMRDCGKHACNRKCCGDQCPPCEKICGKQLSCNKHKCQSVCHNGP 449
            |.:.|.|||.||:.||:||.:.|.|.:|.|.||||...||||:..||:.|.|..|||.||||.|.
Zfish   416 GRYSKLLPCHKEYLCESKCNKTRACSRHQCKRKCCPGNCPPCDMNCGRMLGCRNHKCPSVCHQGS 480

  Fly   450 CYPCKLESQINCRCGKTKKSVPCGRERSARIV-CLELCRITPKCHHAI--KHRCHKGDCPPCGQV 511
            ||||....::.|.||.|..|||||||||.:.. |.|||:..|.||||.  |||||.|.||||.|.
Zfish   481 CYPCPEMVKVGCECGSTVISVPCGRERSTKPPRCKELCKKPPSCHHASQEKHRCHFGPCPPCKQP 545

  Fly   512 CGLPNDTSKCGHICKARCHEAVRVNKPKEA-------RPQAKKYEYKALPHPRCEEGVIVTCIGG 569
            |.|  ..:.|.|:|.|.||:.|.|.....|       :|....:...|||.|.|...:...|:|.
Zfish   546 CQL--TLAGCVHLCPAPCHDQVLVKATDRANLAGPWEQPSTPAFVRTALPCPPCLVPIPTACLGE 608

  Fly   570 HEVATWPCWNSKPTSCQRSCARQLKCGNHKCSLVCHFV-PLPQDMSAQTG--CANCEEGCTVPRP 631
            |||:..||....|.||.|.|.|.|.||||||||.||.| |.|.......|  |..|||||..|||
Zfish   609 HEVSPVPCHARGPFSCGRLCGRTLSCGNHKCSLECHHVTPTPNSDKTMAGQECVRCEEGCVKPRP 673

  Fly   632 TGCIHACPKGCHPPPCAPCNFVIKTKCHCGLNQLVYKCNEYYDETGSVQEIIERREKLRSCGNRC 696
            .||.|.|...||...|.||..:::.:|||.::.|..:|.::    .|..|  :.::.|.||.|:|
Zfish   674 AGCAHPCVLPCHRSACPPCQLMLRQRCHCKISSLYIECLKF----TSADE--QDKQLLMSCQNQC 732

  Fly   697 LKNYPCGHRCTAICHTGKCPNPELCRKKVRIFCACKRLKQEIACDKHRAGQTFLDCDSNCKAEQI 761
            .|...|||||..:||.|.|  .:.|.:||:|.|.|||:|::..|.:.::....|.||..|  :.:
Zfish   733 PKQLLCGHRCKLLCHAGDC--DQNCGQKVKIRCPCKRIKKDFPCSRVQSQDGLLVCDETC--QTL 793

  Fly   762 RVQAAEQLQLEQKR--RDEEERNRLELEKFEAKFGKRKHKERKTVGSGPAKTKID---WQRRAIY 821
            :.:.||....|::.  ..|..:.:.|||.||.:...|:.|.||.     .:.::|   |.|..:.
Zfish   794 QKKHAEACAAEERALLEGEMRKQQAELEAFEKRQKGRRKKNRKV-----TEVEMDEGVWHRYKLR 853

  Fly   822 AVSILTVVGAIVVAFY 837
            .:.....|...|.|||
Zfish   854 LLLPFCGVLLAVAAFY 869

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15011NP_647879.1 NF-X1-zinc-finger 184..228 CDD:100116 30/44 (68%)
NF-X1-zinc-finger 239..288 CDD:100116 18/49 (37%)
NF-X1-zinc-finger 293..342 CDD:100116 29/50 (58%)
NF-X1-zinc-finger 347..395 CDD:100116 28/48 (58%)
NF-X1-zinc-finger 426..474 CDD:100116 26/48 (54%)
NF-X1-zinc-finger 692..740 CDD:100116 22/48 (46%)
nfxl1XP_002666590.3 NF-X1-zinc-finger 272..320 CDD:100116 18/49 (37%)
NF-X1-zinc-finger 325..372 CDD:100116 29/49 (59%)
NF-X1-zinc-finger 378..426 CDD:100116 28/48 (58%)
NF-X1-zinc-finger 457..505 CDD:100116 26/48 (54%)
NF-X1-zinc-finger 728..776 CDD:100116 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C362235517
eggNOG 1 0.900 E1_KOG1952
Hieranoid 1 1.000
Homologene 1 1.000 H26752
Inparanoid 1 1.050 752 1.000 Inparanoid score I534
OMA 1 1.010
OrthoDB 1 1.010 D299100at2759
OrthoFinder 1 1.000 FOG0007112
OrthoInspector 1 1.000 T1054457
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12360
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5752
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.990

Return to query results.
Submit another query.