DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14997 and Sqor

Sequence 1:NP_647877.1 Gene:CG14997 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001041378.2 Gene:Sqor RGDID:1564504 Length:450 Species:Rattus norvegicus

Alignment Length:438 Identity:218/439 (50%)
Similarity:295/439 (67%) Gaps:16/439 (4%)


  Fly    15 LLLATHNHAPTAFSTRFLSTSRVNRERQECQVLVVGGGTGGCAMAAKLSSRLGSDKVVVLEPEDK 79
            |.|.|....|....|....|::.:.|     |||:|||:||..||.::..|:|::.|.::||.::
  Rat    20 LRLGTQQAGPLQLHTGACCTAKNHYE-----VLVLGGGSGGITMATRMKRRVGAENVAIVEPSER 79

  Fly    80 HYYQPMFTLIGGGMKRLDQSHRQMADVLPTKAKWVKEKALEFDPDNNTVSTSGGKTIKYDFLIIA 144
            |:|||::||:|.|.|.|..|.|....|:|:..:|::::..|.:||.|.:.|..||.|.|.:||||
  Rat    80 HFYQPIWTLVGAGAKELSSSDRSTLSVIPSGVQWIQDRVAELNPDQNCIRTDNGKEISYRYLIIA 144

  Fly   145 TGLQLNYGKIPGLVEALETPDSNVCSIYSPKYVDHVYECLRRTNKGNAIFTFPNCPIKCAGAPQK 209
            .|:||:|.||.||.|....|  .:.|.||.|.|:..::.|:...:|||:|||||.|:||||||||
  Rat   145 LGIQLDYEKIKGLPEGFAYP--KIGSNYSVKTVEKTWKALQDFKEGNALFTFPNTPVKCAGAPQK 207

  Fly   210 IAYISEHYFRKMGRRDNVNIIYNTSLPVIFGVKHYAEALMKLIKRRNITLNVQRNLVEVRHKDNI 274
            |.|:||.||||.|:|...|||:||:|..|||||.||:||.::|:.||:::|.:.||:|||.....
  Rat   208 IMYLSEAYFRKTGKRSKANIIFNTALGTIFGVKKYADALQEIIRERNVSVNYKHNLIEVRADKQE 272

  Fly   275 AVFEDLAKPG----VHYEETYSMLHVTPPMSTPDVVANCKKLVTPTGFVDVDQLTLQHNKYSNVF 335
            ||||:|.|||    :|||    |||||||||:|||:.. ..:....|:||||:.||||.||.|||
  Rat   273 AVFENLDKPGETHVIHYE----MLHVTPPMSSPDVLKR-SPVADSAGWVDVDKETLQHKKYPNVF 332

  Fly   336 AIGDSASSPNSKTAAAAAAQSPVVFKNVMAAIEGKAPTDIYDGYSSCPIVTGYSSCILAEFDYNL 400
            .|||..:.|.||||||.||||.::.:.:...::.:.||..||||:|||:||||:..|||||||..
  Rat   333 GIGDCTNLPTSKTAAAVAAQSGILDRTISLIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYTA 397

  Fly   401 TPVETFPLDQSKERYSMFFMKKELMPVLYWKLMMNGYWNGPALMRKIF 448
            .|:||||.||||||.||:.||.::||.|||.:|:.|||.|||.:||:|
  Rat   398 QPLETFPFDQSKERISMYLMKADMMPFLYWNMMLRGYWGGPAFLRKLF 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 141/287 (49%)
SqorNP_001041378.2 FadH2 46..425 CDD:223523 198/386 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260782321
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 1 1.000 H10921
Inparanoid 1 1.050 445 1.000 Inparanoid score I1558
OMA 1 1.010
OrthoDB 1 1.010 D1267127at2759
OrthoFinder 1 1.000 FOG0003734
OrthoInspector 1 1.000 T1088859
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR10632
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.