DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14997 and Sqor

Sequence 1:NP_647877.1 Gene:CG14997 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001155975.1 Gene:Sqor MGIID:1929899 Length:450 Species:Mus musculus

Alignment Length:434 Identity:213/435 (49%)
Similarity:289/435 (66%) Gaps:8/435 (2%)


  Fly    15 LLLATHNHAPTAFSTRFLSTSRVNRERQECQVLVVGGGTGGCAMAAKLSSRLGSDKVVVLEPEDK 79
            |.|.|....|....|....|::.:.|     |||:|||.||..||.::..|:|::.|.::||.::
Mouse    20 LRLGTQQAGPLQLHTGACCTAKNHYE-----VLVLGGGAGGITMATRMKRRVGAENVAIVEPSER 79

  Fly    80 HYYQPMFTLIGGGMKRLDQSHRQMADVLPTKAKWVKEKALEFDPDNNTVSTSGGKTIKYDFLIIA 144
            |:|||::||:|.|.|.|..|.|....|:|:..:|::::..|.:||.|.:.|..||.|.|.:||||
Mouse    80 HFYQPIWTLVGAGAKELSLSVRSTLSVIPSGVQWIQDRVAELNPDENCIRTDSGKEISYRYLIIA 144

  Fly   145 TGLQLNYGKIPGLVEALETPDSNVCSIYSPKYVDHVYECLRRTNKGNAIFTFPNCPIKCAGAPQK 209
            .|:||:|.||.||.|....|  .:.|.||.|.|:..::.|:...:|||:|||||.|:||||||||
Mouse   145 LGIQLDYEKIKGLPEGFAYP--KIGSNYSVKTVEKTWKALQGFKEGNALFTFPNTPVKCAGAPQK 207

  Fly   210 IAYISEHYFRKMGRRDNVNIIYNTSLPVIFGVKHYAEALMKLIKRRNITLNVQRNLVEVRHKDNI 274
            |.|:||.||||.|:|...|||:||:|..|||||.||:||.::|:.|::::|.:.||:|||.....
Mouse   208 IMYLSEAYFRKTGKRPKANIIFNTALGTIFGVKKYADALQEIIRERDVSVNYKHNLIEVRPDKQE 272

  Fly   275 AVFEDLAKPGVHYEETYSMLHVTPPMSTPDVVANCKKLVTPTGFVDVDQLTLQHNKYSNVFAIGD 339
            ||||.|.|||..:...|.|||||||||.|||:.. ..:....|:||||:.||||.||.|||.|||
Mouse   273 AVFEILDKPGETHVIPYEMLHVTPPMSAPDVLKR-SPVADSAGWVDVDKETLQHKKYPNVFGIGD 336

  Fly   340 SASSPNSKTAAAAAAQSPVVFKNVMAAIEGKAPTDIYDGYSSCPIVTGYSSCILAEFDYNLTPVE 404
            ..:.|.||||||.||||.::.:.:...::.:.|...||||:|||:||||:..|||||||...|:|
Mouse   337 CTNLPTSKTAAAVAAQSGILDRTMCLIMKNQRPIKKYDGYTSCPLVTGYNRVILAEFDYTAQPLE 401

  Fly   405 TFPLDQSKERYSMFFMKKELMPVLYWKLMMNGYWNGPALMRKIF 448
            |||.||||||.:|:.||.::||.|||.:|:.|||.|||.:||:|
Mouse   402 TFPFDQSKERITMYLMKADMMPFLYWNMMLRGYWGGPAFLRKLF 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 138/283 (49%)
SqorNP_001155975.1 Pyr_redox_2 64..354 CDD:285266 148/293 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260781423
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 1 1.000 H10921
Inparanoid 1 1.050 433 1.000 Inparanoid score I1680
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003734
OrthoInspector 1 1.000 T1085311
orthoMCL 1 0.900 OOG5_129122
Panther 1 1.100 LDO PTHR10632
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R564
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.