DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14997 and sqor

Sequence 1:NP_647877.1 Gene:CG14997 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:XP_005163218.1 Gene:sqor ZFINID:ZDB-GENE-050417-436 Length:483 Species:Danio rerio

Alignment Length:448 Identity:210/449 (47%)
Similarity:291/449 (65%) Gaps:14/449 (3%)


  Fly     9 ISQCQKLLLATHNHAPTAFSTRF----------LSTSRVNRERQECQVLVVGGGTGGCAMAAKLS 63
            :|...|.::|:..|.....|.::          :.|......:...:|||:|||:||.||||:|.
Zfish    31 VSFTLKCIMASLLHPQLQLSRQYGRVFSVFNSQIHTGSGLAAKDHYKVLVLGGGSGGIAMAARLK 95

  Fly    64 SRLGSDKVVVLEPEDKHYYQPMFTLIGGGMKRLDQSHRQMADVLPTKAKWVKEKALEFDPDNNTV 128
            .::|::.|.::||.:.|||||::||:|.|.|.:..|.|..:.|:|:...|||.|..||||:.|||
Zfish    96 RKVGAENVAIVEPSEMHYYQPIWTLVGAGAKSVASSGRSTSSVIPSGVTWVKSKVAEFDPEKNTV 160

  Fly   129 STSGGKTIKYDFLIIATGLQLNYGKIPGLVEALETPDSNVCSIYSPKYVDHVYECLRRTNKGNAI 193
            .|..||.|.||:||:|.||:|:|.||.||.|..|.|  .:.|.||.|.|:..::.|:...:|||:
Zfish   161 HTDCGKKISYDYLIVALGLELHYEKIKGLPEGFEHP--KIGSNYSLKTVEKTWDALKSFKEGNAL 223

  Fly   194 FTFPNCPIKCAGAPQKIAYISEHYFRKMGRRDNVNIIYNTSLPVIFGVKHYAEALMKLIKRRNIT 258
            |||||.|:|||||||||.|:|:.:.||.|:|...|||:||||||:||||.||:||.:::|:|::.
Zfish   224 FTFPNTPVKCAGAPQKIMYLSDAFLRKTGKRSKANIIFNTSLPVLFGVKKYADALWEIVKKRDLN 288

  Fly   259 LNVQRNLVEVRHKDNIAVFEDLAKPGVHYEETYSMLHVTPPMSTPDVVANCKKLVTPTGFVDVDQ 323
            :|::.||:|||.....|:||:|.|||......|.||||||||..|.|:.. ..|....|::||::
Zfish   289 VNLRHNLIEVRADKQEALFENLDKPGETEVFKYEMLHVTPPMGPPAVLKG-SLLDDAGGWLDVNK 352

  Fly   324 LTLQHNKYSNVFAIGDSASSPNSKTAAAAAAQSPVVFKNVMAAIEGKAPTDIYDGYSSCPIVTGY 388
            .||||..|.|||.|||..:.|.||||||.||||.|:.:.|...::.:.|...||||:|||:||.|
Zfish   353 NTLQHKTYDNVFGIGDCTNLPTSKTAAAVAAQSAVLDRTVSRILKKQTPDKAYDGYTSCPLVTSY 417

  Fly   389 SSCILAEFDYNLTPVETFP-LDQSKERYSMFFMKKELMPVLYWKLMMNGYWNGPALMR 445
            ::.|||||||:..|:|||| :|||||...|:.||.::||.|||..::.|.|.||...|
Zfish   418 NTVILAEFDYDGQPLETFPVVDQSKESRVMYHMKADVMPHLYWHGLLKGIWGGPGPYR 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 140/283 (49%)
sqorXP_005163218.1 FadH2 78..418 CDD:223523 174/343 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260729001
eggNOG 1 0.900 E1_COG0446
Hieranoid 1 1.000
Homologene 1 1.000 H10921
Inparanoid 1 1.050 411 1.000 Inparanoid score I1797
OMA 1 1.010
OrthoDB 1 1.010 D1267127at2759
OrthoFinder 1 1.000 FOG0003734
OrthoInspector 1 1.000 T1054455
orthoMCL 1 0.900 OOG5_129122
Panther 1 1.100 LDO PTHR10632
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R564
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.