DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14997 and sqor

Sequence 1:NP_647877.1 Gene:CG14997 FlyBaseID:FBgn0035515 Length:457 Species:Drosophila melanogaster
Sequence 2:NP_001015687.1 Gene:sqor XenbaseID:XB-GENE-957726 Length:449 Species:Xenopus tropicalis

Alignment Length:443 Identity:227/444 (51%)
Similarity:294/444 (66%) Gaps:9/444 (2%)


  Fly     6 PGT-ISQCQKLLLATHNHAPTAFSTRFLSTSRVNRERQECQVLVVGGGTGGCAMAAKLSSRLGSD 69
            ||. :.||.:||.|..:.     |.|.|..|..:..::...|:|||||.||..|:|::..::|:.
 Frog     9 PGLHVHQCTQLLRAIQSG-----SCRTLHMSPRSAAKEYYDVVVVGGGAGGITMSARMKRKVGAG 68

  Fly    70 KVVVLEPEDKHYYQPMFTLIGGGMKRLDQSHRQMADVLPTKAKWVKEKALEFDPDNNTVSTSGGK 134
            ||.|:||.:.||||||:||:|||.|:|..|.|..|.|:|:..||:|.:...|||:.|.:.....|
 Frog    69 KVAVIEPSETHYYQPMWTLVGGGAKKLASSARPTASVIPSGVKWIKSEVKGFDPEKNCIRIDDDK 133

  Fly   135 TIKYDFLIIATGLQLNYGKIPGLVEALETPDSNVCSIYSPKYVDHVYECLRRTNKGNAIFTFPNC 199
            .|.|.:||||.||:|.|.||.||.|....|  .:.|.||.|.|:..::.|:...||||||||||.
 Frog   134 EISYKYLIIALGLKLQYEKIKGLPEGFNYP--KIGSNYSVKTVEKTWKALQDFKKGNAIFTFPNT 196

  Fly   200 PIKCAGAPQKIAYISEHYFRKMGRRDNVNIIYNTSLPVIFGVKHYAEALMKLIKRRNITLNVQRN 264
            |:|||||||||.|:||.|.||.|:|.|.|||:||||.||||||.||:||:::||.|:|.:|.:.:
 Frog   197 PVKCAGAPQKIMYLSEEYLRKTGKRSNANIIFNTSLGVIFGVKKYADALLEIIKERDIQVNYKHS 261

  Fly   265 LVEVRHKDNIAVFEDLAKPGVHYEETYSMLHVTPPMSTPDVVANCKKLVTPTGFVDVDQLTLQHN 329
            |:|||.....||||:|.|||......|.||||||||..|||:.| ..:....|:|||.:.||||.
 Frog   262 LIEVRPDVQEAVFENLDKPGETKVFQYEMLHVTPPMGPPDVLVN-SPVSDAAGWVDVSKDTLQHK 325

  Fly   330 KYSNVFAIGDSASSPNSKTAAAAAAQSPVVFKNVMAAIEGKAPTDIYDGYSSCPIVTGYSSCILA 394
            ||.|||.|||..:.|.||||||.||||.|:.|.:...::.::.:..||||:|||:||||...|||
 Frog   326 KYPNVFGIGDCTNLPTSKTAAAIAAQSAVLDKTISFVMKNQSLSAKYDGYTSCPLVTGYRKVILA 390

  Fly   395 EFDYNLTPVETFPLDQSKERYSMFFMKKELMPVLYWKLMMNGYWNGPALMRKI 447
            |||||..|:||||:||.|||.:|:.||.:|||.|||.|::.|||.|||..||:
 Frog   391 EFDYNQQPLETFPIDQGKERRTMYHMKADLMPSLYWYLLLRGYWGGPAPFRKL 443

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14997NP_647877.1 Pyr_redox_2 59..342 CDD:285266 147/283 (52%)
sqorNP_001015687.1 FadH2 51..>344 CDD:223523 154/296 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260788633
eggNOG 1 0.900 E1_COG0446
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H10921
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1267127at2759
OrthoFinder 1 1.000 FOG0003734
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.